KEGG   Prochlorococcus marinus NATL1A: NATL1_21851Help
Entry
NATL1_21851       CDS       T00467                                 

Definition
NAD binding site:D-amino acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NATL1_21851
   00330 Arginine and proline metabolism
    NATL1_21851
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    NATL1_21851
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    NATL1_21851
Enzymes [BR:pme01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     NATL1_21851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1845347..1846459
Genome map
AA seq 370 aa AA seqDB search
MQMNSQKTEKKHTEISIVGGGIAGITTAFHLGKKGYQINLIDPTLNSEINNLNPKNGTQA
SLGVLMGNIYKRSKGRAFLLRKKSMKLWKEWLTQINYSETDLILEKPLIKLASSDKEYQS
MIELSHNKKTYGIELLDQNSLDFWNSIFETRLIGGLISHEDGRLNPIKLIKSLMESLDQI
KINKIEKSVIRISKNNNLNDKSWTINLENNQSINQDYIIICSALNTQNLLKPLGHEILLE
PILGQVIELELKKETPNWKEWPAILNYQSINFIHHDPNRMLIGATVEKGTKPSQLDKQKM
LNLRNGSPKWMLNAKVCHEWSGIRARPTNEAAPLLKQLEPGLLINTGHYRNGVLLAPACA
EWIGLQIEGQ
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatgaatagccaaaaaacagaaaaaaaacacaccgaaatctcaattgttggaggt
gggatagcaggaattacaactgcctttcatttagggaaaaaaggttatcaaataaattta
atcgacccaacattaaattcagaaataaataatttaaatccaaaaaatggaacacaagct
agtttgggtgttctcatgggaaatatctacaaaagatcaaaaggaagagcttttttacta
agaaaaaaaagtatgaaattatggaaagaatggcttacacaaataaactattctgagaca
gatttgattcttgaaaaaccattaattaaattagcaagttcagacaaagagtatcaatca
atgattgaattaagtcataataaaaaaacttatggaattgaacttttagatcaaaattct
ttagatttctggaattctatatttgagacaagattaatagggggattaatatctcatgaa
gatggtcgattaaatccaataaagttaatcaagtcattaatggaaagtcttgatcaaatc
aagataaataaaatcgagaaaagtgttattagaataagtaaaaataataatttaaatgat
aaaagctggactattaatcttgaaaataatcaatctattaatcaagattatatcatcatt
tgttctgcattaaatactcaaaatttattaaaaccattaggtcatgaaatacttttagaa
ccaatattaggacaagttattgaattagaattaaaaaaagaaactccgaattggaaagaa
tggcctgcaatattaaattatcaatctataaactttatacaccatgatcccaatcgcatg
cttataggagcaactgtcgaaaaaggaactaaaccaagccaattagataaacaaaaaatg
ctgaacctgagaaacggttctccaaaatggatgctcaatgcaaaagtctgtcatgaatgg
agcggaataagagctagaccaactaatgaagcagctcccttattaaaacaactagaacca
ggtctattaattaatacaggtcactacagaaatggtgttttattagctcctgcttgcgcc
gaatggataggacttcaaattgagggccaataa

DBGET integrated database retrieval system