KEGG   Prochlorococcus marinus MIT 9215: P9215_06781Help
Entry
P9215_06781       CDS       T00598                                 

Gene name
glk
Definition
putative glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P9215_06781 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9215_06781 (glk)
   00052 Galactose metabolism
    P9215_06781 (glk)
   00500 Starch and sucrose metabolism
    P9215_06781 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    P9215_06781 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    P9215_06781 (glk)
   00524 Butirosin and neomycin biosynthesis
    P9215_06781 (glk)
Enzymes [BR:pmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     P9215_06781 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(602516..603550)
Genome map
AA seq 344 aa AA seqDB search
MNFLACDLGGTKVLLGIFEKVINEDSPKLIFKKKYISSNWGSFELILEDFLKKECKNITH
PSSACFAVAGPLSNNNAKIINLSWNISGNTLQDKFNFKSCELINDFAVQIYGIPFLKKNQ
YSTIQNGSHSEGANNDLHAIVGAGTGLGIARGIISGKKVKVLASEGGHVEYSPKSKLEWE
LKIWLKNYLKIERISCERIISGTGLSRIAEWRLSKPDAQNHPLQKYLKKIKIFDASRKEL
PEKICNLSKEGDQLMIEVERIWLGAYASLLGDVALQELCFGGLWISGGTASKHFKNFKSD
LFLKQFFDKGRLKDILKTIPMKVILDEEFGLFSAACRAKMLLKT
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaattttctcgcttgtgatttaggaggtacaaaggttctattggggattttcgaaaaa
gtaataaatgaagattcgcctaagttaatattcaagaagaaatatatatcatctaattgg
ggttcttttgaactaatcctagaagattttctcaaaaaagaatgcaaaaatattactcat
ccttcttcagcatgtttcgccgtagctggtcctttatccaacaacaacgcaaaaatcatt
aacttgtcatggaatatttctggaaatactttacaggacaaatttaattttaaaagctgc
gagctaataaatgatttcgctgtacaaatttatggaataccttttttaaaaaaaaatcaa
tattctactatccaaaatggatcccattctgaaggtgctaataatgatctgcatgccatt
gttggagcgggtactggtttgggcattgcaagaggaataatatcagggaaaaaggtaaaa
gttttagctagtgaaggtggtcatgttgagtactccccaaaatcaaaattagaatgggaa
ttaaaaatttggctcaagaattatttaaaaattgaaaggatatcttgtgaaagaattatt
agcggcactggtttatcaagaattgccgaatggagactaagcaaacctgatgcccagaac
catcctctacaaaaatatttaaagaaaattaagatttttgatgcttctagaaaagaacta
cctgaaaaaatttgtaatctttctaaagaaggagatcagctaatgattgaagttgagagg
atttggctaggtgcttatgcatctttattgggagatgttgctcttcaagaattgtgcttt
ggcgggttatggatttctggaggaaccgcatcaaaacatttcaaaaactttaaatcagat
ttatttttaaaacaatttttcgacaagggtagattaaaagatattcttaaaacaatacct
atgaaagtaattttagatgaagagtttggactttttagtgcagcctgcagagcaaaaatg
cttttaaaaacctaa

DBGET integrated database retrieval system