KEGG   Prochlorococcus marinus NATL2A: PMN2A_0651Help
Entry
PMN2A_0651        CDS       T00267                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PMN2A_0651
DNA repair and recombination proteins [BR:pmn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PMN2A_0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1142892..1143440
Genome map
AA seq 182 aa AA seqDB search
MPGIGPRTAQRLALHLLRQPEYKIRLFSEALLNAKSQVGQCKTCFHLTAGEQCEICLNKQ
RNQELICVVSESRDLLALERTREYKGLYHVIGGLISPMDGIGPEMLEISSLIKRVDKANI
KEVILALTPSIEGDTTSLYVGRLLKPFTKVTRIAYGLPVGSELEYADEVTLSRALEGRRD
LD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttgcccggtatcggtccaagaactgctcaaagattagctcttcatcttttgcgtcagcca
gaatacaaaatcagattgttttcagaagctctacttaatgcgaaaagtcaggtaggtcaa
tgtaagacgtgctttcatctaaccgcaggagaacaatgcgaaatttgtctaaacaagcaa
agaaatcaagaactcatttgcgttgtttctgagtcaagagatttacttgctcttgagcgc
actagagagtacaaagggctttatcatgtaattggtgggttaatttctccgatggatggg
attggacctgaaatgcttgagatatcaagtcttatcaaaagagtcgataaagcaaatata
aaagaagtcatccttgccctaacaccaagtattgaaggggatacgactagtctttatgtg
ggtagattattaaaaccattcacaaaagtcactcgtattgcttatggacttcctgttgga
agtgagttggaatatgccgatgaagtaacactctcacgtgctttagaaggtcgtagagac
ttagattaa

DBGET integrated database retrieval system