KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_0894Help
Entry
PMCN06_0894       CDS       T01776                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pmv00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pmv00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:pmv03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:pmv03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pmv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(970863..971291)
Genome map
AA seq 142 aa AA seqDB search
MSKHAQFYLLSEQAQMEKMACDFAASAWRLGKRVLIACETEQQALDIDEALWAREADEFV
PHNLSGEVTTYATPIEVSWKGKRNAQRRDLLINLQAEVPDYVSSFTQVIDFVPVEEHLKV
LARERYKQLRQLGWQLSTEQIK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacacgcgcaattttatttgttaagcgagcaagcacaaatggaaaaaatggct
tgtgattttgccgcatccgcgtggcgtcttggtaagcgcgtgttaattgcttgcgaaact
gaacaacaagcgttggatattgatgaagccttatgggcaagagaggcagatgagtttgtg
ccgcataatttatcaggtgaagtgacgacgtatgctacaccgattgaggtgagctggaaa
ggtaagcgtaatgcgcaacgcagagatctcttgattaatttacaggcagaggtaccagat
tatgtcagcagttttacacaggtgattgattttgtgccagtggaagagcatttaaaagtg
ctagccagagagcgttataaacaattacgacaacttggctggcaattatcaacagagcaa
atcaagtaa

DBGET integrated database retrieval system