KEGG   Parastagonospora nodorum: SNOG_15669Help
Entry
SNOG_15669        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
pno  Parastagonospora nodorum
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Motif
Other DBs
NCBI-GeneID: 5982740
NCBI-ProteinID: XP_001805810
UniProt: Q0TY36
Position
Unknown
AA seq 108 aa AA seqDB search
MGFENGDHKKGANLFKTRCAQCHTLKEGEGNKIGPNLHGLFGRKTGQVEGYSYTDANKQK
GITWDENTLFEYLENPKKYIPGTKMAFGGLKKPKDRNDLITFLQEETK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcgagaacggtgaccacaagaagggtgccaacctcttcaagacccgatgcgct
cagtgccataccctgaaggagggtgagggcaacaagatcggccccaacctacacggcctc
ttcggccgcaagactggtcaggtcgagggttactcatacaccgacgccaacaagcagaag
ggcatcacctgggacgagaacaccttgttcgagtacctcgagaaccccaagaagtacatt
cccggaaccaagatggctttcggtggtctcaagaagcccaaggaccgcaacgacctgatt
accttcctccaggaggagaccaaataa

DBGET integrated database retrieval system