KEGG   Phaeosphaeria nodorum: SNOG_15669Help
Entry
SNOG_15669        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
pno  Phaeosphaeria nodorum
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SNOG_15669
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 108 aa AA seqDB search
MGFENGDHKKGANLFKTRCAQCHTLKEGEGNKIGPNLHGLFGRKTGQVEGYSYTDANKQK
GITWDENTLFEYLENPKKYIPGTKMAFGGLKKPKDRNDLITFLQEETK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcgagaacggtgaccacaagaagggtgccaacctcttcaagacccgatgcgct
cagtgccataccctgaaggagggtgagggcaacaagatcggccccaacctacacggcctc
ttcggccgcaagactggtcaggtcgagggttactcatacaccgacgccaacaagcagaag
ggcatcacctgggacgagaacaccttgttcgagtacctcgagaaccccaagaagtacatt
cccggaaccaagatggctttcggtggtctcaagaagcccaaggaccgcaacgacctgatt
accttcctccaggaggagaccaaataa

DBGET integrated database retrieval system