KEGG   Polaromonas sp. JS666: Bpro_5135Help
Entry
Bpro_5135         CDS       T00343                                 

Definition
(GenBank) Semialdehyde dehydrogenase, NAD - binding
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00360  Phenylalanine metabolism
pol00362  Benzoate degradation
pol00620  Pyruvate metabolism
pol00621  Dioxin degradation
pol00622  Xylene degradation
pol00650  Butanoate metabolism
pol01100  Metabolic pathways
pol01120  Microbial metabolism in diverse environments
pol01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bpro_5135
   00650 Butanoate metabolism
    Bpro_5135
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Bpro_5135
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpro_5135
   00622 Xylene degradation
    Bpro_5135
   00621 Dioxin degradation
    Bpro_5135
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bpro_5135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA Rossmann-like
Motif
Other DBs
NCBI-ProteinID: ABE47002
JGI: Bpro5135
UniProt: Q120P0
Position
1:246117..247061
Genome map
AA seq 314 aa AA seqDB search
MTKSQRLQVAIIGSGNIGTDLMIKVMRNSKHLSMGAMVGIDAASDGLARAGRLGVPVTHE
GITGLVGLPNFGDIRIAFDATSAGAHAGHNEVLQRHGVKVIDLTPAAIGPYVIPVVNLEE
QLSSPNINMVTCGGQATIPIVRAVSQIARVRYAEIVASIASKSAGPGTRANIDEFTETTS
AAIVSVGRAEHGKAIIVLNPAEPSLMMRDTVFCLVDADADQEAIRLSVRDMVRSVAAYVP
GYRLKQDVQFDVIPDKAPVNVPGIGRVSGLKVSVFLEVEGAAHYLPAYAGNLDIMTSAAL
AAADKIAASLITAR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgactaaatctcaacgcttgcaggtggcgatcatcggctcgggcaatatcggcaccgac
ctgatgatcaaggtcatgcgcaacagcaaacatctgtcgatgggtgcgatggtaggcatc
gacgcagcgtctgacggtctggctcgtgctgggcggctgggtgttcccgtgacacatgaa
ggcatcactggcctggtcggactgccgaactttggagatatccgcattgctttcgatgcg
acttcggcaggtgcgcatgccggacacaacgaagtcttgcagcgtcatggggtcaaggtg
atcgaccttaccccggcggccatcggtccgtatgtgatacctgtggtgaaccttgaggaa
cagctgtcgagcccgaacatcaacatggtgacctgtgggggacaggcgaccattcccatc
gtgcgcgcggtctcgcagatagcccgcgttcgttatgcggaaatcgtggcttcgattgcc
agcaaatccgctggcccgggcacgcgcgcaaatatcgacgaattcaccgaaaccacgtca
gcagccattgtcagtgtcggccgcgccgaacatggcaaggccatcattgtgcttaatccc
gccgaaccgtcgctgatgatgcgagacaccgtcttctgcctggtggatgccgatgcagat
caagaagctatccggctatccgttcgggacatggtccggagcgtagctgcttatgttccc
ggctatcgactcaagcaagacgttcaattcgacgttatcccggataaggcgccggtcaac
gtacctggcatcggccgcgtctcaggcctgaaggtctcggtcttccttgaagtcgaaggg
gccgctcactacctgccggcatacgccggaaacctcgacatcatgacgtcggcagccttg
gccgctgctgacaagatcgccgccagtttgatcacggcccgctaa

DBGET integrated database retrieval system