KEGG   Polaromonas sp. JS666: Bpro_5135Help
Entry
Bpro_5135         CDS       T00343                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
pol  Polaromonas sp. JS666
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bpro_5135
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bpro_5135
   00650 Butanoate metabolism
    Bpro_5135
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Bpro_5135
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpro_5135
   00622 Xylene degradation
    Bpro_5135
   00621 Dioxin degradation
    Bpro_5135
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bpro_5135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:246117..247061
Genome map
AA seq 314 aa AA seqDB search
MTKSQRLQVAIIGSGNIGTDLMIKVMRNSKHLSMGAMVGIDAASDGLARAGRLGVPVTHE
GITGLVGLPNFGDIRIAFDATSAGAHAGHNEVLQRHGVKVIDLTPAAIGPYVIPVVNLEE
QLSSPNINMVTCGGQATIPIVRAVSQIARVRYAEIVASIASKSAGPGTRANIDEFTETTS
AAIVSVGRAEHGKAIIVLNPAEPSLMMRDTVFCLVDADADQEAIRLSVRDMVRSVAAYVP
GYRLKQDVQFDVIPDKAPVNVPGIGRVSGLKVSVFLEVEGAAHYLPAYAGNLDIMTSAAL
AAADKIAASLITAR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgactaaatctcaacgcttgcaggtggcgatcatcggctcgggcaatatcggcaccgac
ctgatgatcaaggtcatgcgcaacagcaaacatctgtcgatgggtgcgatggtaggcatc
gacgcagcgtctgacggtctggctcgtgctgggcggctgggtgttcccgtgacacatgaa
ggcatcactggcctggtcggactgccgaactttggagatatccgcattgctttcgatgcg
acttcggcaggtgcgcatgccggacacaacgaagtcttgcagcgtcatggggtcaaggtg
atcgaccttaccccggcggccatcggtccgtatgtgatacctgtggtgaaccttgaggaa
cagctgtcgagcccgaacatcaacatggtgacctgtgggggacaggcgaccattcccatc
gtgcgcgcggtctcgcagatagcccgcgttcgttatgcggaaatcgtggcttcgattgcc
agcaaatccgctggcccgggcacgcgcgcaaatatcgacgaattcaccgaaaccacgtca
gcagccattgtcagtgtcggccgcgccgaacatggcaaggccatcattgtgcttaatccc
gccgaaccgtcgctgatgatgcgagacaccgtcttctgcctggtggatgccgatgcagat
caagaagctatccggctatccgttcgggacatggtccggagcgtagctgcttatgttccc
ggctatcgactcaagcaagacgttcaattcgacgttatcccggataaggcgccggtcaac
gtacctggcatcggccgcgtctcaggcctgaaggtctcggtcttccttgaagtcgaaggg
gccgctcactacctgccggcatacgccggaaacctcgacatcatgacgtcggcagccttg
gccgctgctgacaagatcgccgccagtttgatcacggcccgctaa

DBGET integrated database retrieval system