KEGG   Pongo abelii (Sumatran orangutan): 100173133Help
Entry
100173133         CDS       T01416                                 

Gene name
HIST1H2BC
Definition
histone cluster 1, H2bc
Orthology
K11252  
histone H2B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:pon05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:pon05322]
Human Diseases; Substance dependence; Alcoholism [PATH:pon05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagccagccaagtctgctcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaagatggcaagaagcgcaagcgcagccgcaaggagagttactctgtg
tacgtgtacaaggtgctgaagcaggtccatccagacactggcatttcttccaaggctatg
ggcatcatgaattctttcgttaacgacatatttgaacgcatcgcgggcgaggcttcccgc
ctggcgcattacaacaagcgctcgaccatcacttccagggagatccagacggccgtgcgc
ctgctgcttcccggagagctggccaagcacgccgtgtcggagggcaccaaggccgtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system