KEGG   Pongo abelii (Sumatran orangutan): 100434717Help
Entry
100434717         CDS       T01416                                 

Gene name
PADI6
Definition
(RefSeq) protein-arginine deiminase type-6
  KO
K01481  protein-arginine deiminase [EC:3.5.3.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100434717 (PADI6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAD PAD_M PAD_N
Motif
Other DBs
NCBI-GeneID: 100434717
NCBI-ProteinID: XP_009232738
Ensembl: ENSPPYG00000001806
Position
1
AA seq 686 aa AA seqDB search
MSFQSIVHLSLDSPAHAVCVLGTEICLDLSGCAPQKCQCFTIHGSGRVLINMANTVISEK
EDATIWWPLSDPTYATVKMISPSPSVDGDKVSVTYYGPNEDAPVGTAVLYLTGIEVSLEV
DIYRNGQVEMSSDKQAKKKWIWGPSGWGAILLVNCNPADVGQQLEDKKTKKVIFSEEITN
LSQMTLSVQGPTCILKKYRLVLHTSKEESKKARVYWPQKDNSSTFELVLGPGQHAYTLAL
LGSHLKETFYVEAIAFPSAEFSGLISYSVSLVEESQDPSIPETLLYKDTVVFRVAPCVFI
PCTQVPLEVYLCRELQLQGFVDTVTELSEKSNSQVASVYEDPNRLGRWLQDEMAFCYTQA
PHKTTSLILDTPQATDLDEFPMKYSLSPGVGYMIQDTEDHNVASMDSIGNLMVSPPVKVQ
GKEYPLGRVLIGSSFYPSAEGRAMSKTLRDFLYAQQVQAPVELYSDWLMSGHVDEFMCFI
PTDDKNEGEKGFQLLLASPSACYKLFREKQKEGYGDALLFDELRADQLLSNGREAKTIDQ
LLADESLKKQNEYVEKCIHLNRDILKKELGLVEQDIIEIPQLFCLEKLTNIPSDQQPKRP
FARPYFPDLLRMIVMGKNLGIPKPFGPQIKGTCCLEEKICCLLEPLGFKCTFINDFDCYL
TEVGDICACANIRRVPFAFKWWKMVP
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtccttccagagtatcgtccacctgtccctggacagccctgcccatgccgtttgtgtg
ttgggcacagaaatctgcttggatctcagcgggtgtgccccccagaaatgccagtgtttc
accatccatggctctgggagggtcttgatcaatatggccaacacagtgatttctgagaag
gaggatgccaccatctggtggcccctgtctgatcccacgtacgccacagtgaagatgata
tcgcccagcccttcagtggatggggataaggtctcggtcacgtactatgggcccaacgag
gatgcccccgtgggcacagctgtgctgtacctcactggcattgaggtctctctagaggta
gacatctaccgcaatgggcaagttgagatgtcaagtgacaaacaggctaagaaaaaatgg
atctggggtcccagcggttggggtgccatcctgcttgtgaattgcaaccctgctgatgtg
ggccagcaacttgaggacaagaaaaccaagaaagtgatcttttcagaggaaataacgaat
ctgtcccagatgacactgagtgtccaaggccccacttgtatcttaaagaaatatcggcta
gtcctccatacctccaaggaagagtcgaagaaggcgagagtctactggcctcaaaaagac
aactccagtacctttgagttggtgctggggcccggccagcatgcctataccttggccctc
cttgggagccacttgaaggagactttctacgttgaagctatagcattcccgtccgctgaa
ttctcaggcctcatctcctactctgtgtccctggtggaggagtctcaagacccgtcgatt
ccagagactctgctgtacaaagatacggtggtgttccgggtggctccctgtgttttcatt
ccctgtacccaggtgcctctggaggtttacctgtgcagggagctgcagctgcagggtttt
gtggacacagtgacggagctgagtgagaagagcaacagccaggtggcatctgtctatgag
gatcccaaccgcctgggcaggtggctccaggatgagatggccttctgctacacccaggct
ccccacaagacaacgtctttgatcctcgacacgcctcaggccaccgatcttgatgagttc
cccatgaagtactcactgagccctggtgttggctacatgatccaggacactgaggaccat
aatgtggccagcatggattccattgggaacctgatggtgtccccacctgtcaaggtccaa
gggaaagagtaccccctgggcagagtcctcattggcagcagcttttaccccagtgcagaa
ggccgggccatgagtaagaccctccgagacttcctctatgcccagcaggtccaagcgccg
gtagagctctactcagattggctaatgtctggccacgtggatgagttcatgtgcttcatc
cccacagatgacaagaatgagggcgaaaagggcttccagctgctcctggccagccccagt
gcctgctataaactgttccgagagaaacagaaggaaggctatggcgatgctcttctgttt
gacgagcttagagcagatcagctcctgtctaatggaagggaagccaaaaccatcgatcaa
cttctggctgatgaaagcctgaagaagcagaatgaatacgtggagaagtgcattcacctg
aaccgtgacatcctgaagaaggagctgggcctggtggaacaggacatcatcgagattccc
cagctgttctgcttggagaagctgactaacatcccctctgaccagcagcccaagaggccc
ttcgcgaggccatacttccctgacctgctgcggatgattgtgatgggcaagaacctgggg
atccccaagcctttcgggccccaaatcaaggggacctgctgcttggaagaaaagatttgc
tgcttgctggagcccctgggcttcaagtgcaccttcatcaatgactttgactgttacctg
acggaggttggagacatctgtgcctgtgccaacatccgccgggtgccctttgccttcaaa
tggtggaagatggtaccttag

DBGET integrated database retrieval system