KEGG   Pongo abelii (Sumatran orangutan): 100441270Help
Entry
100441270         CDS       T01416                                 

Gene name
CDKN2D
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
FoxO signaling pathway
Cell cycle
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:pon04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:pon04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 166 aa AA seqDB search
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALEL
LKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNAPDGTGALPIHLAVQEGHT
AVVSFLAAESDLPARDARGLTPLELALQRGAQDLVDILQGHMVAPL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaggaggttcgcgccggcgaccggctgagtggggcggcggcccggggcgac
gtgcaggaggtgcgccgccttctgcaccgcgagctggtgcatcccgacgccctcaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttggcagcaccgccatcgccctggagctg
ctgaagcaaggtgccagccccaatgtccaggacacctccggtaccagtccagtccatgac
gcagcccgcactggattcctggacaccctgaaggtcctagtggagcacggggctgatgtc
aatgcgcctgatggcaccggggcacttccaatccatctggcagttcaagagggtcacact
gctgtggtcagctttctggcagctgaatctgatctcccagcaagggacgccaggggtctc
acacccttggagctggcactgcagagaggagctcaggacctcgtggacatcctgcagggc
cacatggtggccccgctgtga

DBGET integrated database retrieval system