KEGG   Pongo abelii (Sumatran orangutan): 100441270Help
Entry
100441270         CDS       T01416                                 

Gene name
CDKN2D
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
FoxO signaling pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100441270 (CDKN2D)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100441270 (CDKN2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 166 aa AA seqDB search
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALEL
LKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNAPDGTGALPIHLAVQEGHT
AVVSFLAAESDLPARDARGLTPLELALQRGAQDLVDILQGHMVAPL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaggaggttcgcgccggcgaccggctgagtggggcggcggcccggggcgac
gtgcaggaggtgcgccgccttctgcaccgcgagctggtgcatcccgacgccctcaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttggcagcaccgccatcgccctggagctg
ctgaagcaaggtgccagccccaatgtccaggacacctccggtaccagtccagtccatgac
gcagcccgcactggattcctggacaccctgaaggtcctagtggagcacggggctgatgtc
aatgcgcctgatggcaccggggcacttccaatccatctggcagttcaagagggtcacact
gctgtggtcagctttctggcagctgaatctgatctcccagcaagggacgccaggggtctc
acacccttggagctggcactgcagagaggagctcaggacctcgtggacatcctgcagggc
cacatggtggccccgctgtga

DBGET integrated database retrieval system