KEGG   Pongo abelii (Sumatran orangutan): 100450383Help
Entry
100450383         CDS       T01416                                 

Gene name
LYZL1
Definition
lysozyme-like 1
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 195 aa AA seqDB search
MQDTHLSCLSPTKWSSVSSTDSTEKSASGAGTRNLPFQFCLRQALRMKAVGILTLIGCLV
TGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGI
FQINSFAWCRRGKLKENNYCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCE
GRDLSEWKKGCEVVS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacactcacctgagctgcctgtcaccgactaagtggagcagtgtttcttccaca
gactcaactgagaagtcagcctctggggcaggcaccaggaatctgccttttcagttctgt
ctccggcaggctttgaggatgaaggctgtgggcattctgaccctcattggctgcctggtc
acaggcgccgagtccaaaatctacactcgttgcaaactggcaaaaatattctcgagggct
ggcctggacaattactggggcttcagccttggaaactggatctgcatggcgtattatgag
agcggctacaacaccacggcccagacggtcctagatgatggcagcattgactacggcatc
ttccagatcaacagcttcgcgtggtgcagacgcggaaagctgaaggagaacaactactgc
cacgtcgcctgctcagccttgatcactgatgacctcacagatgcgattatctgtgccagg
aaaattgttaaagagacacaaggaatgaactattggcaaggctggaagaaacactgtgaa
ggcagagacctgtccgagtggaaaaaaggctgtgaggttgtttcctaa

DBGET integrated database retrieval system