KEGG   Pongo abelii (Sumatran orangutan): 100453479Help
Entry
100453479         CDS       T01416                                 

Gene name
TYR
Definition
(RefSeq) tyrosinase
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00350  Tyrosine metabolism
pon01100  Metabolic pathways
pon04916  Melanogenesis
Module
pon_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100453479 (TYR)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100453479 (TYR)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     100453479 (TYR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase Laminin_EGF LapA_dom DUF1191 BT1
Motif
Other DBs
NCBI-GeneID: 100453479
NCBI-ProteinID: XP_002822383
Ensembl: ENSPPYG00000003755
UniProt: H2NEX0
Position
11
AA seq 529 aa AA seqDB search
MLLAVLYCLLWSFQTSAGHFPRACVSSKNLMEKECCPPWNGDRSPCGQLSGRGSCQNILL
SNAPLGPQFPFTGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNCTERRLLVR
RNIFDLSAPEKDKFFAYLTLAKHTISSDYVIPIGTYGQMKNGSTPMFNDINIYDLFVWMH
YYVSMDALLGGSEIWRDIDFAHEAPAFLPWHRLFLLRLEQEIQMLTGDENFTIPYWDWRD
AEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLRRN
PGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQS
SMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLQEVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSKDLGYDYRYLQDSDPDSFQDYIKSYLEQASRIWSWLLG
AAMVGAVLTALLSGLVSLLCRHKRKQLPEEKQPLLLEKEDYHSLYQSHL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggctgttttgtactgcctgctgtggagtttccagacctccgctggccatttc
cctcgagcctgtgtctcctctaagaacctgatggagaaggaatgctgcccaccatggaac
ggggacaggagtccctgtggccagctttcaggcagaggttcctgtcagaatatccttctg
tccaatgcaccacttgggcctcaatttcccttcacaggggtggatgaccgggagtcgtgg
ccttccgtcttttataataggacctgccagtgctctggcaacttcatgggattcaactgt
ggaaactgcaagtttggcttttggggaccaaactgcacagagagacgactcttggtgaga
agaaacatctttgatttgagtgccccagagaaggacaaattttttgcctacctcacttta
gcaaagcataccatcagctcagactatgtcatccccatagggacctacggccaaatgaaa
aatggatcaacacccatgtttaacgacatcaatatttatgacctctttgtctggatgcat
tattatgtgtcaatggatgcactgcttgggggatctgaaatctggagagacattgatttt
gcccatgaagcaccagcttttctgccttggcatagactcttcttgttgcggttggaacaa
gaaatccagatgctgacaggagatgaaaacttcactattccatattgggactggcgggat
gcagaaaagtgtgacatttgcacagatgagtacatgggaggtcagcaccccacaaatcct
aacttactcagcccagcatcattcttctcctcttggcagattgtctgtagccgattggag
gagtacaacagccatcaatctttatgcaatggaacgcccgagggacctttacggcgtaat
cctggaaaccatgacaaatccagaaccccaaggctcccctcttcagctgacgtagaattt
tgcctcagtttgacccaatatgaatctggttccatggataaagctgccaatttcagcttt
agaaatacactggaaggatttgctagtccacttactgggatagcagatgcctctcaaagc
agcatgcacaatgccttgcacatctatatgaatggaacaatgtcccaggtacagggatct
gccaacgatcccatcttccttcttcaccatgcatttgttgacagtatttttgagcagtgg
ctccgaaggcaccgtcctcttcaagaagtttatccggaagccaatgcacccattggacat
aaccgggaatcctatatggttccttttataccactgtacagaaatggtgatttctttatt
tcatccaaagatctgggctatgactatagatatctacaagattcagacccagactccttt
caagactacattaagtcctatttggaacaagccagtcggatctggtcatggctccttggg
gcggcgatggtaggggccgtcctcactgccctgctgtcagggcttgtgagcttgctgtgt
cgtcacaagagaaagcagcttcctgaagaaaagcagccactcctcctggagaaagaggat
taccacagcttgtatcagagccatttgtaa

DBGET integrated database retrieval system