KEGG   Pongo abelii (Sumatran orangutan): 100457536Help
Entry
100457536         CDS       T01416                                 

Gene name
MAP2K3
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3 isoform X1
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04015  Rap1 signaling pathway
pon04218  Cellular senescence
pon04620  Toll-like receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04714  Thermogenesis
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon05014  Amyotrophic lateral sclerosis (ALS)
pon05145  Toxoplasmosis
pon05164  Influenza A
pon05169  Epstein-Barr virus infection
Module
pon_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100457536 (MAP2K3)
   04010 MAPK signaling pathway
    100457536 (MAP2K3)
   04668 TNF signaling pathway
    100457536 (MAP2K3)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100457536 (MAP2K3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100457536 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    100457536 (MAP2K3)
  Endocrine system
   04912 GnRH signaling pathway
    100457536 (MAP2K3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100457536 (MAP2K3)
  Environmental adaptation
   04714 Thermogenesis
    100457536 (MAP2K3)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100457536 (MAP2K3)
  Infectious diseases
   05164 Influenza A
    100457536 (MAP2K3)
   05169 Epstein-Barr virus infection
    100457536 (MAP2K3)
   05145 Toxoplasmosis
    100457536 (MAP2K3)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100457536 (MAP2K3)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE7 family
   100457536 (MAP2K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH Choline_kinase RIO1 DUF4344
Motif
Other DBs
NCBI-GeneID: 100457536
NCBI-ProteinID: XP_002827186
Ensembl: ENSPPYG00000008073
UniProt: H2NT13
Position
17
AA seq 347 aa AA seqDB search
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcccgcctcgagccagcccgccagcatgccccagtccaaaggaaaatccaag
aggaagaaggatctacggatatcctgtatgtccaagccacccgcacccaaccccacaccc
ccccggaacctggactcccggaccttcatcaccattggagacagaaactttgaggtggag
gctgatgacttggtgaccatctcggaactgggccgcggagcctatggggtggtagagaag
gtgcggcacgcccagagcggcaccatcatggccgtgaagcggatccgggccaccgtgaac
tcacaggagcagaagcggctgctcatggacctggacatcaacatgcgcacggtcgactgc
ttctacactgtcaccttctatggagcactattcagagagggagacgtgtggatctgcatg
gagctcatggacacatccttggacaagttctaccggaaggtgctggataaaaacatgaca
attccagaggacatccttggggagattgctgtgtctatcgtgcgggccctggagcatctg
cacagcaagctgtcggtgatccacagagatgtgaagccctccaatgtcctcatcaacaag
gagggccatgtgaagatgtgtgactttggcatcagtggctacttggtggactctgtggcc
aagacgatggatgccggctgcaagccctacatggcccctgagaggatcaacccggagctg
aaccagaagggctacaatgtcaagtcggacgtctggagcctgggcatcaccatgattgag
atggccatcctgcggttcccttacgagtcctgggggaccccgttccagcagctgaagcag
gtggtggaggagccgtccccccagctcccagccgaccgtttctcccccgagtttgtggac
ttcactgctcagtgcctgaggaagaaccccgcagagcgtatgagctacctggagctgatg
gagcaccccttcttcaccttgcacaaaaccaagaagacggacattgctgccttcgtgaag
gagatcctgggagaagactcatag

DBGET integrated database retrieval system