KEGG   Pongo abelii (Sumatran orangutan): 100459108Help
Entry
100459108         CDS       T01416                                 

Gene name
HEXDC
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pon00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 482 aa AA seqDB search
MSGSTPFKMRLVHLDLKGAPTKGLIFPLFRALGANGLLIEYETXFPYEGPLRLLRAKYAY
SPSEIKEILHLAGLNELEVIPLVQTFGHMEFVLKHAAFAHLREVGPFPCTLNPHEEESLA
LVGAMIDQVLELHPGAQWLHVGCDELYYLGEGEASRRWLQQEQNSAGKLCLSHMRAVASH
VKARRPSVTPLVWDDMLRDLPEDQLAASGVPQLVEPVLWDYAADLDVHGKVLLMQKYRRC
GFPRLWAASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQGIILTGWQRYDHY
SVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVENLLGISSLEITDAVREGAGSFPGSN
ILALVTQVSLHLRSSVDALLEGNRYVTGWFSPYHRRRKLIHPVMVQHIQPAVLSLLAQWS
TLVQELEAALQLAFYPDAVEEWLEENVHPSLQQLQALLQDLSEVSAPPLPPTSPGRDAAQ
DP
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggttccacgccatttaagatgagattagttcatttagaccttaaaggagctccg
accaaaggtctcatttttcctctgttccgggcactaggtgcaaacggcctcctcattgag
tatgaaacatgntttccctacgagggccctctgaggctgctgagggccaagtacgcctac
agcccctctgaaatcaaagagatcctgcatctggctggactcaatgagctggaggtgatt
cccttggtgcagacatttggacacatggagtttgtgctgaagcacgcagccttcgcccac
ctgcgggaggtgggccccttcccctgcaccctgaacccccacgaggaggagtccctggcg
ctggtgggcgccatgatcgaccaggtcctggagctgcacccaggtgcccagtggctgcac
gtcggatgtgatgagctctattacctcggagagggggaggcctcgcgccggtggctgcag
caagagcagaacagcgcagggaagctgtgcctgtcacacatgcgggcggtggccagccac
gtgaaggcccggcgccccagcgtgacacccctggtgtgggacgacatgctccgagacctg
cctgaggaccagcttgcagcgtccggggtgccgcagctggtggagccggtgctctgggac
tacgcggctgacctggatgtgcacggcaaggtcctcctcatgcagaagtaccggcggtgc
ggctttccgcggctgtgggcagccagtgccttcaagggtgccacggggcccagccaggcc
gtgccccctgtcgagcaccacctcaggaaccacgtgcagtggctgcaggtggcgggcagc
gggcccacggactcactgcagggcatcatcctgaccggctggcagaggtacgaccactac
tctgtgctgtgcgagctgctccccgcaggagtcccgtccctggccgcctgcctgcagttg
cttctacgcggaggatttgatgaagatgttaaagcgaaagtggagaaccttcttgggatt
tccagcctggaaataacggatgctgttagggagggggccggctctttccctggcagcaac
atccttgcccttgtcacacaagtcagcctccatctgcgcagctctgtggacgcgctgctg
gagggcaacaggtatgtcactggctggttcagcccctaccaccgccggcggaagctcatc
cacccggtcatggttcagcacatccagcccgcagtgctcagcctcctggcgcagtggagc
accctcgtgcaggagctggaggctgccctgcagctggctttctacccggatgccgtggag
gagtggctggaggaaaacgtgcaccccagcctgcagcagctgcaagctctgctgcaggac
ctcagcgaggtatccgcccccccgctgccaccgaccagccctggcagggatgctgctcag
gacccctga

DBGET integrated database retrieval system