KEGG   Pongo abelii (Sumatran orangutan): 100460680Help
Entry
100460680         CDS       T01416                                 

Definition
non-secretory ribonuclease-like
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 161 aa AA seqDB search
MVSKLFTSQICLLLLLGLLAVDGSLHVKPPQFTWAQWFETQHINMTSQQCNNAMQVINNF
QRRCKNQNTFLRTTFANVVNVCGNPNITCPSNRSRNNCHHSGVQVPLIHCNLTTPSPQNI
SNCRYAQTPANMFYIVACDNRDPRRDPPQYPVVPVHLDRII
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaaaactgttcacttctcaaatttgtctgcttcttctgttggggcttctggct
gtggacggctcactccatgtcaaacctccacagtttacctgggctcaatggtttgaaacc
cagcacatcaatatgacctcccagcaatgcaacaatgcaatgcaggtcattaacaatttt
caacggcgttgcaaaaaccaaaatacttttcttcgtacaacttttgctaatgtagttaat
gtttgtggtaacccaaatataacctgtcctagtaacagaagtcgcaacaattgtcatcat
agtggagtccaggtgcctttaatccactgtaacctcacaactccaagtccacagaatatt
tcaaactgcaggtatgcgcagacaccagcaaacatgttctatatagttgcatgtgacaac
agggatccacgacgggaccctccacagtatccggtggttccagttcacctggatagaatc
atctaa

DBGET integrated database retrieval system