KEGG   Pongo abelii (Sumatran orangutan): 100462288Help
Entry
100462288         CDS       T01416                                 

Gene name
PPOX
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pon00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 477 aa AA seqDB search
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVESSERLGGWIRSVRGPNGAIFELGPRG
IRPAGALGAQTLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGLRGLLRPSP
PFSKPLFWAGLRELTTPRGKDPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGSGRTPQPDSALIRQALAERWSQWSLRGGLEMLPQAL
ETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSELLPAEAA
PLARALSAITAVSVAVVNLQYRGAHLPVQGFGHLVPSSEDPAVLGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIP
QYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPKS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaccgtggtcgtgctgggcggaggcatcagcggcttggccgccagttaccac
ctgagccgggccccctgcccccctaaggtggtcctggtggagagcagtgagcgtctggga
ggctggattcgctccgttcgaggcccgaatggtgctatctttgagcttggacctcgggga
attaggccagcgggagccctaggggcccagaccttgctcctggtttctgagcttggcttg
gattcagaagtgctgcctgtccggggagaccacccagctgcccagaacaggttcctctac
gtgggcggtgccctgcatgccctacccactggcctcagggggctactccgcccttcaccc
cccttctccaaacctctgttttgggctgggctgagggagctgaccacgccccggggcaaa
gatcctgatgagactgtgcacagttttgcccagcgccgccttggacctgaggtggcgtct
ctagccatggacagtctctgccgtggagtgtttgcaggcaacagccgtgagctcagcatc
aggtcctgctttcccagtctcttccaagctgagcaaacccatcgttccatattactgggc
ctgctgctggggtcagggcggaccccacagccagactcagcactcattcgccaggccttg
gctgagcgctggagccagtggtcacttcgtggaggtctagagatgttgcctcaggccctt
gaaacccacctgactagtaggggggtcagtgttctcagaggccagccggtctgtgggctc
agcctccaggcagaagggcgctggaaggtatctctaagggacagcagtctggaggctgac
cacgttattagtgccattccagcttcagtgctcagtgagctgctccctgctgaggctgcc
cctctggctcgtgccctgagtgccatcactgcagtgtctgtagctgtggtgaatctgcag
taccgaggagcccatctgcctgtccagggatttggacatttggtgccatcttcagaagat
ccagctgtcctgggaatcgtgtatgactcagttgctttccctgagcaggatgggagcccc
cctggcctcagagtgactgtgatgctgggaggttcctggttacagacactggaggcgagc
ggctgtgtcttatctcaggagctgtttcaacagcgggcccaggaagcagctgctacacaa
ttaggactgaaggagatgccgagccactgcttggtccatctacacaagaactgcatcccc
cagtatacactaggtcactggcaaaaactagagtcagctaggcaattcctgactgctcac
aggttgcccctgactctggctggagcctcctatgagggggttgctgttaatgactgtata
gagagtggccgccaggcagcagtcagtgtcctgggcacagaacctaagagctga

DBGET integrated database retrieval system