KEGG   Pichia pastoris: PAS_chr1-4_0249Help
Entry
PAS_chr1-4_0249   CDS       T01092                                 

Definition
Acetyl-CoA carboxylase, biotin containing enzyme
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ppa  Pichia pastoris
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ppa01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ppa00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:ppa00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(1853491..1855200,1855259..1860196)
Genome map
AA seq 2215 aa AA seqDB search
MSSVNHSLRHSKLPPHFLGLNSVEVAAPSKVRDFVRDHGGHSVITRVLIANNGIAAVKEI
RSVRKWAYETFGNDRAIQFIVMATPEDLEANAEYIRMADQYVMVPGGTANNNYANVDLIV
EIAESTDAHAVWAGWGFASENPHLPEQLAASPKKIIFIGPPGSAMRSLGDKISSTIVAQH
AKVPCIPWSGTGVDQVIIDPVSNLVSVDEETYAKGCCSDPQDGLAKAKAIGFPVMIKASE
GGGGKGIRKVDREEDFLSLYDQAANEIPGSPIFIMKLAGDARHLEVQLLADQYGTNISLF
GRDCSVQRRHQKIIEEAPVTIAKQDTFRQMEQAAVRLGQLVGYVSAGTVEYLYSHAEDKF
YFLELNPRLQVEHPTTEMATGVNLPVAQLLIAMGIPLNRIRDIRVLYGLEPNGATEIDFE
FKTEESLKSQRKPIPKGHTIACRITSEDPGEGFKPSGGALYELNFRSSSSVWGYFSVGNK
SSIHSFSDSQFGHIFSFGENRQIARKNMVVALKELSIRGDFRTTIEYLIKLLETADFENN
TITTGWLDELISKKLTAERPDETTAILCGAEKGQIPGKELLRTIFPIEFIYEGKKYKFTV
VQAAFDKYNVFVNGCMITVSVTHLKDGSLLVALDGKSHSVYYLQEEVGNTRLSVDGKSCI
LEVEHEPTELRTPSPGKLIKYLVEHGDHVKIGQPYAEVEVMKMCMPLVSQENGTIRLLKQ
PGSSVAAGDILAILALDDPSKVKHALPFDGTIPDMKQPFIHSNKPVYKFISLLSVLKNIL
AGYDNQVVMNDTLQSLLDVLKNPELPYSEWNHSISALHSRLPIHLDEQLTSLIERSHQRG
ADFPAKHLLKLLDKEQAVNPDPLFSQVIAPLTAVAKSYEHGLEVHEHNVFADLITQYYDI
ESLFADKREEDVILQLRDENKSSLDKVIDVVLSHSRVGAKNHLIRAILEIYQTICQNDLQ
AATILKKPLKKIVELDSRFTAKVSLKAREILIQCSLPSIKERSDQLEHILRSSVVQTQYG
ESFNGNYKLPNLDVIQDVIDSKYIVFDVLTQFVVSPNKYIFAAAAEVYLRRAYRAYSVRE
VKHHFVGDSALPIVEWKFQLPLLSTAAYNSVPEAMRNSSSNRSSISMDRAVSVSDLTFMI
NKNDSQPLRTGIIIPTNHLDDIEESLSSAIDVFPKRPRNNGPAPDRTNVAPEQPTNVCNV
FIANVSGYNSEAEIVDKISSVLSELKDDLRASGVRRVTFVLGDKVGTYPKYYTFKFPDYF
EDETIRHIEPALAFQLELRRLSNFNIKPVPTENRNIHVYEAVAKNTSCIDRRFFTRGIIR
TSRIREDVTISEYLISEANRLMSDILDALEIIDTSNTDLNHIFINFSAVFNVTPDDVEAA
FGGFLERFGRRLWRLRVSAAEIRIMCTDPETGIPFPLRALINNVSGYVVKSEMYQEVKND
HGEWVFKSLGPTPGSMHLRPISTPYPTKEWLQPKRYKAHLMGTTYVYDFPELFRQATLSQ
WKKYSPTARVPSDVFVANELIVDDSGELTEVSREPGANVVGMVAFKVTAKTPEYPRGRHF
IIIANDITFKIGSFGPQEDEYFNKATQLARKLGIPRIYLSANSGARIGVAEELLPLFKVA
WKEEGKPSKGFEYLYLTSEDLTLLEKSGKSNSVTTQRIVEEGEERHVITAIIGASDGLGV
ECLRGSGLIAGATSRAYKDIFTITLVTCRSVGIGAYLVRLGQRAIQIEGQPIILTGAPAI
NKLLGREVYSSNLQLGGTQIMYKNGVSHLTANDDLAGVEKIMDWLAYVPAKRNMPVPILE
SLHDKWDRDVDYKPTRNEPYDVRWMISGRETPDGEFESGLFDSGSFTETLSGWAKGVVVG
RARLGGIPMGVIGVETRVTENLIPADPANPDSTEMMIQEAGQVWYPNSAFKTAQAINDFN
NGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDFKQPIFTYIPPTAELRGGSW
VVVDPTINEDMMEMYADVESRAGVLEPEGMVGIKYRKDKLLATMERLDAKYAELKSKVSD
TSLSEKDVSEIKKQIEQREKQLLPIYAQISIQFADLHDRSGRMLAKGVIKKELEWVNSRR
FFFWRVRRRLNEEYLIKRITEFLSASATRLDKISRINSWLPTSIDLEDDQKVAIWLEENR
KALDANIKELRAEHVRRTLATLVRTDMDTTSKSLAELINLLPETEKESILSKIKS
NT seq 6648 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgttaaccactctctccgtcattcaaagctaccgccgcatttccttggtctc
aactcggttgaagtcgctgctccctccaaggtcagagactttgtcagggaccatggtggc
cactcggtcatcacgagagtgctgatcgcaaacaacggtatagctgccgtgaaagaaatt
cgttccgtcaggaaatgggcgtatgaaacgtttggtaacgatagagccattcaatttatt
gttatggctaccccagaggatcttgaagctaatgctgaatatattcgaatggctgaccag
tatgtcatggtcccaggaggaactgcaaacaacaactatgcgaacgtcgacctcattgta
gaaatagcagaatctactgatgctcatgctgtttgggctggttggggttttgcctccgaa
aatccccatttgcctgagcaactggccgcttctcctaagaagattatcttcattggccct
ccgggctctgccatgcgatctcttggtgacaagatttcctctactattgtcgcacaacat
gctaaagtcccatgtattccttggtcaggaactggtgtcgatcaggttataatcgacccc
gtaagcaatttggtttccgttgatgaagaaacgtacgccaaaggatgctgttccgatcca
caggacggtttggcaaaagccaaggctattggtttccctgtgatgattaaagcttccgaa
ggtggtggtggtaaaggaattagaaaagttgacagggaggaagattttctttctctttat
gatcaagctgctaatgaaattccaggttccccaatttttatcatgaagcttgctggagat
gccaggcatttggaagttcaattacttgctgatcaatatggaaccaacatctcccttttt
ggaagagattgttccgttcaaagaagacaccaaaagatcatagaagaggcaccagttacc
attgccaaacaagacactttcaggcaaatggaacaagccgctgtcagactgggtcaattg
gttggatacgtttctgccggtaccgttgagtatctatattcacacgctgaggacaagttc
tacttcttggaactgaaccctcgtcttcaagttgagcatccaaccacagaaatggccaca
ggtgtcaatcttccagttgcccagttgctaattgcaatgggtattcctttgaatagaatc
agagatatcagggtactttacggacttgaaccaaatggcgctacagaaattgactttgaa
ttcaaaactgaagaaagcttgaagagtcaaagaaaacccattccaaagggtcacactatt
gcatgtcgtatcacatctgaagatcctggtgaaggttttaagccttctggtggtgctcta
tatgagctaaatttcagatcttcttctagcgtttggggttacttcagtgtaggaaacaaa
tcctcaattcattctttcagtgactctcaatttggtcatatattctcgtttggcgaaaac
cgtcaaatcgccagaaaaaatatggtcgtcgccttgaaagagctttctattcgtggtgac
tttagaactacaattgagtacttaataaaactgttggaaacagctgatttcgagaacaac
accatcactactggttggttggacgaactgatctcgaagaagctgactgctgaaagacct
gatgaaaccacagcaattttatgtggtgctgaaaaaggtcaaatcccaggcaaagaactt
cttcgtactattttcccaattgaatttatttatgaaggaaagaagtacaagtttactgtg
gttcaggctgcatttgacaaatacaacgtctttgtcaacggatgtatgattactgtaagt
gtaacccatttgaaggatggcagtttattggtagcacttgatggtaaatcccattctgtc
tattacttgcaggaagaagtcggaaatactaggttgtcggtggatggtaaatcttgcatt
ttagaagttgagcatgagccaactgaacttcgtactccatctccaggtaaacttatcaaa
tatcttgtggaacacggtgatcacgtcaaaattggacaaccttacgctgaagttgaagta
atgaagatgtgtatgcctttggtcagtcaggagaatggaactatcaggttattgaagcag
ccaggatcttcggttgccgctggagacatccttgctattcttgcattggatgatcccagc
aaggtgaagcatgctttgccattcgatggtacaatccctgatatgaaacagccatttatc
catagcaacaaaccagtttataagttcatttctcttctctccgtgctgaaaaacatttta
gcagggtatgataatcaagttgtgatgaacgatactctgcagagtctattggatgtgttg
aagaaccctgaacttccttattcggaatggaatcattcgatatctgcacttcattcaagg
ttaccaattcatttggacgaacaattgaccagtttgattgagagatcgcatcaacgtggt
gcagactttccagctaagcacttgctcaagcttttggacaaggagcaggctgttaatcct
gatccacttttctcccaggtcattgcgcctcttactgctgttgccaaaagctacgaacat
ggacttgaagttcatgaacacaatgtattcgccgatttgatcacccaatactacgacata
gagagcttgtttgccgataaaagggaggaagatgttattttacagctacgtgatgagaac
aaatcgtcccttgacaaggtcatcgatgtcgtcttgtcacattccagagttggagctaag
aaccatttaatcagagctattctggaaatttatcaaactatctgccaaaatgatctccaa
gctgcaaccattttgaagaaacctttgaaaaagattgttgagctagattctagatttaca
gcaaaggtttcgttaaaagctagagagattttgattcaatgttcccttccctctatcaaa
gaacgttcagaccagctcgagcatatccttcgatcttcagttgtacaaactcagtacgga
gagagcttcaatggaaactacaaactgcctaacttggacgttatacaagacgtaattgat
tccaagtacattgtattcgatgttttgacacaatttgttgttagcccaaacaagtatata
tttgcagcagcagccgaggtgtatctgcgaagagcttacagggcttactcggtgagagaa
gttaaacatcatttcgtaggtgattctgctctcccaattgtggaatggaagttccaattg
ccgctgttatcaacagctgcttacaattccgtgcctgaagctatgagaaactcctccagt
aaccgatcctctatttcaatggatagagcagtttctgtctccgatttgaccttcatgatc
aacaagaatgattctcaacctttgagaacaggtatcataattcccacaaaccacttagat
gacattgaggagtccttgtcatctgccattgatgtcttccctaaacgtccacgtaacaat
ggaccagctcctgacagaactaatgtggctcctgagcaacctactaacgtatgcaatgtt
ttcattgccaatgtttctggctacaacagtgaggctgagatcgttgacaagattagcagc
gttctttctgagttgaaagacgacctcagggctagtggcgttcgaagagttacctttgtc
ttgggagacaaggttggaacttatccaaaatactataccttcaaatttccagactatttt
gaagacgagacaatccgtcacatagagcctgctcttgcgttccagctggaactaagaaga
ttgtccaatttcaatattaaacctgttccaactgagaatagaaatattcatgtgtatgag
gcagttgccaaaaatacttcatgcattgacaggagattttttactaggggtatcatcaga
acaagcagaatcagagaggatgtgactatctctgaataccttatcagcgaagctaatcgt
cttatgagtgacattttggacgctcttgagattattgatacctccaacactgatttgaac
catatattcatcaatttctctgctgttttcaatgtcacgccagatgacgttgaagcagcg
ttcggtggtttcttagaaaggtttggacgtaggctgtggagactacgtgtttctgctgct
gaaatccgtattatgtgcacggaccctgagactggtatcccattcccacttcgtgcttta
attaacaacgtttcaggatacgttgtgaaatctgaaatgtatcaagaggtgaaaaatgat
catggggaatgggttttcaaaagtcttggtcctacaccaggttcaatgcaccttagacca
atttcaacaccatacccaaccaaagaatggcttcaaccaaaacgttacaaagctcatctt
atgggtactacttacgtgtatgatttccctgaattattccgtcaagctacgctctcccaa
tggaaaaaatactctcctactgcgagagttccttctgatgtgtttgtggccaatgaattg
atcgtcgatgattcaggtgaactaactgaagtaagcagagaacccggcgccaacgttgtg
ggtatggtggccttcaaggtaaccgcaaaaactcctgagtatccacgcggtcgccatttc
atcataattgctaatgatatcaccttcaagatcggatcctttggccctcaagaagatgaa
tatttcaacaaggccacacaacttgcaagaaaattgggcattcctcgaatttatctgtca
gccaactcgggtgctagaattggagttgctgaagaacttcttccattattcaaagtagcc
tggaaggaagaaggtaaaccaagcaagggatttgaatacttatacctcacatcggaagat
cttactctattggaaaagtccggaaagtctaacagcgttaccactcaaagaatagttgaa
gaaggcgaagaacgccacgttataactgccatcattggagctagtgatggactgggtgtt
gaatgtctaagaggttccggtttgatcgctggtgctacatctcgggcgtacaaggacatc
ttcactatcacattggtcacctgtagatctgttggtattggtgcttacttggtcagattg
ggtcaacgagccattcaaattgaaggacaaccaataattttgactggtgcccctgctatt
aataagttgttgggtagggaagtgtactcttccaacctgcaacttggtggtacccagatt
atgtacaagaacggtgtttcacacttaaccgccaatgatgatctcgcaggtgtcgaaaag
attatggattggttagcttatgtgcctgctaagagaaacatgcctgttcctattttagaa
tcacttcatgacaaatgggacagagatgtggactataagcctacaagaaatgagccgtac
gacgtcagatggatgatcagtggacgtgaaactcctgatggtgagttcgaatctggattg
tttgactctgggtccttcactgaaactttgagtggatgggctaaaggtgtagtcgtcgga
agagcccgtttaggtggtattcctatgggagtcattggtgttgaaactagagtcacagaa
aacctgattccagctgatcccgccaatccagactcaaccgaaatgatgattcaagaagct
ggtcaagtctggtaccctaacagtgccttcaagactgcacaagctatcaacgatttcaac
aatggtgaacagctacccttgatgattttggccaactggagaggtttctctggtggtcaa
agagacatgtacaatgaagttttgaaatacggttctttcattgtggatgctttagtcgac
ttcaagcagcctatcttcacttacattcctcccactgctgagttgagaggtggatcttgg
gttgttgtagaccctaccatcaatgaagacatgatggaaatgtatgcagacgtcgaatca
agagcaggtgttttggaaccagaaggtatggtaggtatcaaataccgtaaggacaaactc
cttgctactatggaacgattggatgccaaatatgctgagcttaaatccaaggttagcgat
actagtctttcagaaaaggatgtttccgagatcaagaaacaaattgagcagagagagaag
caattgttgccaatttatgcacaaatctctattcaatttgctgatcttcatgacagatct
ggtcgtatgttggccaagggtgtcattaaaaaggaactggaatgggttaattctcgtcgt
ttcttcttctggagagtccgtcgtcgtttgaacgaggaatacctcattaagcgtattacc
gaattcctatctgcttctgctaccagattggacaagatctcgaggatcaattcttggttg
ccaacatcgattgatttggaagatgaccagaaggttgccatttggttggaagaaaaccgt
aaagctcttgacgccaatatcaaggagctcagggctgagcatgttagaagaactctggct
actcttgtcagaactgatatggatactacttccaagagtttggctgaattgatcaacctt
cttcctgaaaccgaaaaggaatcaattttatctaagatcaagtcatag

DBGET integrated database retrieval system