KEGG   Pichia pastoris: PAS_chr2-2_0213Help
Entry
PAS_chr2-2_0213   CDS       T01092                                 

Definition
Histone acetyltransferase catalytic subunit of NuA3 complex that acetylates histone H3, involved in
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PAS_chr2-2_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1989267..1991366
Genome map
AA seq 699 aa AA seqDB search
MVEARSRRTAVLNNLKIENNKIFTLLHDEIFKSMDDDSSNTKKQRHLRERKSTPDYNVIN
NFRSTQARDDSSEPENARLSRPRSPRAQSLKSSPLKSLIVTLKMDPTRLARVFSASKEEL
PYRGILTYEEGNTFNTRPTAETYEMFQAALRDSKQMKKEYGDDTLVKPLDEEELRKEAIS
QSYAPLAKLRCIHFGDKEIDTWYNSPYPEEYTSKYVLHICEHCLKYTDSSFVLDRHLLKC
AYKYMPPGNEIYRDRCVSVFEVDGRKNTIYCQNLCLLAKLFLNSKTLYYDVEPFMFYVLY
EIKPASEHYSFVGYFSKEKLNSTNYNVSCILTLPTHQRKGYGNFLIEFSYLLTRREYKLG
TPEKPLSELGLLSYRNYWKHTVCRSIKWIIDNVSPEMLPFLTVSISDICDISGMVANDVV
TALEQLEMLVKQHDQKYGILVDMEVIEEVLSNWDSKNYLKIQPENLIWKSVVLGPSGGIN
TTSTMVVAAPDSNNPNGNNSESKSANSISIITNFMTDDLEDERDVEEQALSAILERVQSN
KETYSGNTSELEDVSWEVMHPATTENNQSIVYKPIGRPSKVVAPIDEEELGIIFNDSDNN
SNEEESEDDDYNEDLIDEEEEDEEEEDSENIDEAIIIEEEEKEEEGVEKASPLRKAENAD
NTRHDTYRRTISTAKKRHSKLKPVTRPPFRRTRSSRLNN
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagcacgctccagacgaacagctgtgctaaataacctgaagattgaaaacaat
aaaatcttcacactcttgcatgacgagatcttcaaatctatggatgatgactcttccaat
acaaagaaacaacgacatcttcgcgagagaaagtcaactccagactataatgtcatcaat
aacttcaggtcgactcaagcgcgtgacgattcttctgaaccagagaatgctaggctatca
cgacccagatccccgagggctcaaagtttgaagtcaagtccgctcaaatctcttattgtt
actttgaaaatggaccccacgcggctggctcgagttttttcagccagtaaggaggagcta
ccttatcgtgggatactaacctacgaggagggcaacaccttcaatacgagaccaactgcg
gaaacctatgaaatgtttcaagcagctttgagagatagtaagcaaatgaaaaaagaatac
ggggacgacaccttggtcaaaccgctagacgaagaagaactgaggaaagaggctatatcg
caaagttatgcaccattagccaaacttcgatgcatacatttcggtgataaggaaattgac
acatggtacaactcaccctatccggaggagtacacttccaagtatgtccttcatatttgt
gagcattgcttaaagtacacagactctagcttcgttttagatagacatctattgaagtgt
gcttataaatatatgcctcctggtaatgaaatttacagagatagatgtgtctctgttttt
gaggttgatggaagaaagaacacgatttactgccagaatttgtgccttttggccaaactg
tttttgaactccaagacactatattatgatgttgagccatttatgttttatgttttatac
gaaataaaacctgcttcggaacactattcctttgtaggctatttttcgaaagaaaaactg
aactctaccaattataacgtgagttgtatccttacccttcccactcaccaacggaaaggt
tatgggaactttttgatagagtttagttatttattgaccagacgcgagtacaaacttgga
acgcctgaaaagcccttgagtgaactgggtttgctaagctacagaaattactggaagcat
acagtttgccgatctatcaaatggattatagataatgtctctccagaaatgctcccattt
ttgacagtatcgatatctgacatctgtgatatttcagggatggttgcaaatgacgttgtc
acagcccttgagcagttagagatgttagtcaagcagcacgatcagaagtatgggatactg
gtggatatggaagttatcgaggaagttctcagtaactgggattcaaaaaactacttaaag
attcaaccagagaatcttatttggaaaagtgtagttcttggcccttcgggtggcattaat
accaccagcacgatggtggttgcagctcctgattcgaacaatccaaatggaaataacagt
gaatctaaatcggcgaacagtatatccatcatcaccaattttatgaccgatgatttggag
gacgaaagagacgtggaagagcaggcgctttcggccatactggaaagagtacagagtaat
aaagagacctattcagggaacacttccgagttggaagatgtaagttgggaggttatgcat
cctgcaaccacagaaaacaatcaatccattgtgtacaagccgattggtagaccttctaaa
gtagttgcccccatagatgaggaggagcttggcattattttcaacgactcagacaacaac
agtaatgaggaagaaagtgaggacgacgactataatgaggacttaatagatgaagaggaa
gaagatgaagaagaggaagattctgagaacatagacgaagcgataataatagaagaagaa
gaaaaggaggaggaaggggttgagaaagcctctccattgcgaaaggcagaaaatgcggat
aatacaaggcatgatacatatcggaggacaattagcacagccaaaaaaagacacagcaaa
ctgaagccagttaccagaccaccttttagaaggactcgaagctcccgacttaataattag

DBGET integrated database retrieval system