KEGG   Pseudopropionibacterium propionicum: HMPREF9154_1665Help
Entry
HMPREF9154_1665   CDS       T02180                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
ppc00340  Histidine metabolism
ppc01100  Metabolic pathways
ppc01110  Biosynthesis of secondary metabolites
ppc01230  Biosynthesis of amino acids
Module
ppc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    HMPREF9154_1665 (hisD)
Enzymes [BR:ppc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     HMPREF9154_1665 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh POTRA_3
Motif
Other DBs
NCBI-ProteinID: AFN47526
UniProt: I6WW99
Position
complement(1800832..1802133)
Genome map
AA seq 433 aa AA seqDB search
MLRTVDLTSLEGDYRSHVPRAALDVAGAMEAVRGVCDAVRDRGTEALAEYSQRFDGVVPG
TFRVPERVLAGAAGQLDPELREAFEESIRRRRLVAETLERDSDPAPTILAEGARVGLRNI
PVERVGLYVPGGLAPLASSVIMNVVPAQVAGVREIAVASPPQAGFGGWPHPNILALCHML
GVEEVYAVGGAQAIAMFAHGVTGLCAPVAMVTGPGNIYVVAAKRLLRGIVGIDSEAGPTE
IAIIADSSANPAYVAADLISQAEHDPMAASVLITDSPELADLVAAELEPRAAATKHRERI
RTALTGQQSAVLLVRDLDQAVEVADTYAAEHLEIQTRDAGKVASRIRNAGAIFVGDHSPV
SLGDYSAGSTHVLPTAGCACHGSGLNVRSFMRTVHVIDYSAQALSEIADGIERFALAEDL
PGHAAAITVRTRR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgcttagaacggttgacctgaccagcctcgagggcgactaccgctcccacgttcccagg
gcggcgctggacgtcgcgggagccatggaagcggtgcggggggtgtgcgacgcggtccgt
gaccggggaaccgaggcgctcgcagagtactcgcaacgcttcgacggcgtggttcccggg
accttccgggtgccggagcgggtgctggccggggccgccgggcagctcgacccggaactc
cgggaggccttcgaggagtccatcaggcgtcgccgcctggtcgcagaaaccctggaacgc
gattccgatcccgcccccacgatcctggccgagggtgcccgggtggggttgcgcaacatc
cccgtcgaacgggtcggcctctacgttccgggcgggctcgccccactggcctccagtgtg
atcatgaacgtcgttcccgcccaggtggcgggggtccgggaaatcgccgtggcgtccccg
ccgcaggccggtttcggcggttggccgcacccgaacatccttgcgctgtgccacatgctc
ggggtcgaggaggtctacgccgtcggcggggcccaggcaatcgcgatgttcgcccacggg
gtgactggtctctgcgcacccgtcgccatggtcaccggtcccgggaacatctacgtggtg
gctgcgaaacggttgctgcggggaatcgtgggcatcgactccgaggccggacccaccgag
atcgccatcatcgcggactcctccgcgaatcccgcctacgtggccgccgacctgatctcc
caggccgagcacgacccgatggccgcgtccgtcctgatcacggactccccggaactcgcc
gacctggtggcggccgagctggaaccccgggcggcggccacgaaacaccgggaacggatc
cgcaccgccctgacgggtcagcagtcggccgtgttgctggtgcgtgacctcgaccaggcg
gtggaggtggctgacacctacgccgccgagcacctggagatccagacccgcgacgccggg
aaggtggcctcccggatccgcaacgccggcgccatcttcgtcggcgatcactcaccggtc
agcctcggcgactactcggccggctccacccacgtcctaccgaccgcgggctgcgcgtgc
cacggatcgggtctgaacgtgcgctctttcatgcgcaccgtgcatgtcatcgactactcg
gcgcaggccctgagcgaaatcgccgatgggatcgaacggttcgcgctggccgaggacctg
cccgggcacgccgcggccatcacggtcaggacgagacgatga

DBGET integrated database retrieval system