KEGG   Pseudomonas putida GB-1: PputGB1_5381Help
Entry
PputGB1_5381      CDS       T00650                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppg00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6009283..6010188
Genome map
AA seq 301 aa AA seqDB search
MNAMATFQVVTEQHGELNCWRISSDRAELLIAQQGAQILSYQRVGEPPLLWLSDQDIFRQ
GKSVRAGVPVCWPWFGNLQRNPEAVQAMYHAEQAPAHGLARSRDWQLLGIEEVGGGLRIE
FELPEAQGDLPGWPHDVELKLVVELGEALKLNLTSRNMGNTSVTISQALHSYFAVSDVRQ
ARVEGVEGLGYIETLADWEQRQQLGALAFTGETDRIYLDTPSRLSIVDPHWNRRVTLTSN
GSRSAVIWNPWTERARELADMADDGWQRMLCIETANVWDDLVELKPGASHSLGLQIGCEM
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaatggctaccttccaggtcgtaaccgagcaacatggcgaactcaactgctgg
cgtatcagcagcgaccgcgccgaactcctgatcgcccagcagggcgcacagatcctcagc
taccagcgggtgggcgaaccaccgctgctgtggctgagcgaccaggacatcttccgccag
ggcaagtcggtacgcgccggggtaccggtgtgctggccgtggtttggcaacctgcaacgc
aaccccgaggccgtgcaggccatgtaccacgctgagcaggcacctgctcacgggctggcg
cgctcgcgtgactggcagttgctgggcatcgaggaggtgggcggcggcctgcgcattgaa
ttcgaactgcctgaagcgcagggcgacctgcccggctggcctcatgacgtcgagttgaag
ctggtggtggagctgggcgaggcgctgaagctgaacctgaccagccgcaacatgggcaat
acctccgttactatcagccaagccctgcacagctactttgccgtcagcgatgtacgccag
gcacgggtcgaaggggtcgaggggctgggttatatcgaaaccctggcggactgggaacag
cgccagcagctgggagcactggcgtttaccggggagactgaccggatttacctcgacact
ccatcgcgactgagcattgtcgacccgcattggaaccggcgagttaccttgaccagcaat
ggatcacgttcggcggtgatctggaacccctggaccgagcgggcgcgggagctggcagat
atggccgacgatggctggcagcgaatgctgtgcatcgaaacggcgaatgtgtgggatgac
ctggtggaactgaagccgggggcaagtcattcgctgggactgcagatcggttgtgaaatg
atctga

DBGET integrated database retrieval system