KEGG   Pseudomonas putida ND6: YSA_07512Help
Entry
YSA_07512         CDS       T02170                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ppi  Pseudomonas putida ND6
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YSA_07512
Enzymes [BR:ppi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YSA_07512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4071070..4071687
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGTLAEKQPPHLIIDVNGVGYELEVPMTTLYRLPKVGETVTVHTHLVVREDAHLL
YGFAEKRERELFRELIRLNGVGPKLALALMSGLEVDELVRCVQAQDTSALVRVPGVGKKT
AERLLVELKDRFKAWETSPAMFTLVSDGPLPVASESSAEADAVSALVSLGYKPQEASKAI
AAIKDKAGLSSEELIRRSLKGMISK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtttgcgcggcaccctggcggaaaaacaaccgcctcacctgattatcgac
gtcaacggcgtgggttacgaactggaagttcccatgaccacgctgtaccgtctgcccaaa
gtgggtgaaaccgtcacggtgcatacccacctggtcgtgcgcgaagatgcccacttgctc
tacggctttgccgaaaaacgtgagcgcgagttgttccgcgagctgatccgcctgaacggc
gtagggcctaagctggccctggcgctgatgtccgggctggaagtggatgaactggtgcgc
tgcgtgcaggcccaggacacctcagccctggtgcgcgtgccgggcgtcggcaagaaaacc
gccgagcgcttgctggtcgagctcaaggaccgtttcaaggcctgggaaacctcgccggcc
atgttcaccctggtgtccgatgggcctttgccggttgccagcgagtccagtgccgaggcc
gatgcagtcagtgccttggtctcgctgggctacaagccgcaggaagccagcaaggcaatt
gccgcgatcaaggacaaggccggcctgagcagtgaagagctgatccgccgcagcctgaaa
gggatgatttccaagtga

DBGET integrated database retrieval system