KEGG   Photobacterium profundum: PBPRA0399Help
Entry
PBPRA0399         CDS       T00173                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ppr  Photobacterium profundum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppr00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ppr00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:401552..402214
Genome map
AA seq 220 aa AA seqDB search
MGLDDRKRSEGCIYCGCFGYWTGNAWAIVLSSPVSGINLSIPKLAWVYGCYLRRYEVKIS
MIAAMAKDRVIGKDNAMPWHLPADFAWFKKSTLGKPIVMGRKTFESIGRPLPGRLNIVIS
RNPEFSVEGVTVVADIEAAKHAAGDIGELMVIGGGSIYEACLPSADRLYLTFIDLDVDGD
TCFPDWGEGWIKSYTEHYSADEKNAHDMQFVILERNVDLT
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggggcttgatgatagaaaacggtctgaaggctgtatttattgtggctgctttggctat
tggactggcaatgcctgggctattgttttatcgtcgccggtcagtggtataaatttatct
atacccaagttagcttgggtatatgggtgttacttaaggaggtatgaagtgaagatcagt
atgatcgcagctatggctaaagatcgcgttattggtaaagataatgcgatgccatggcat
ttacctgcagattttgcatggtttaagaaatctaccttgggtaagccaattgtgatgggg
cgtaaaacgtttgaatcaattggtcgccctttacctggtcgacttaatattgttattagc
cgtaatcctgaatttagcgtcgaaggtgttacggttgttgccgatatagaagcggcaaag
catgctgctggcgatattggagagttaatggtcattggtggtggcagtatttatgaggcg
tgcttaccaagcgctgatcgcctttatttaacatttatcgatcttgatgttgatggtgat
acttgcttccctgattggggagaaggttggattaaaagttatactgagcactattctgct
gatgaaaagaacgcgcatgatatgcaatttgtgattttagaacgtaacgtcgatcttact
taa

DBGET integrated database retrieval system