KEGG   Photobacterium profundum: PBPRA2997Help
Entry
PBPRA2997         CDS       T00173                                 

Definition
exodeoxyribonuclease V, 67 kDa subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppr  Photobacterium profundum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PBPRA2997
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PBPRA2997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3433343..3435466)
Genome map
AA seq 707 aa AA seqDB search
MMESRSMLKRLQELTKQGALRQLDYQFAKFVALRSPESHSSLVALITALVSHELGKGHVC
LMLNDLNTQSLFGLSSHVSVTLLDGLPEPKHWEAELSGLSVISNMTQGEQHATPLVLQDG
RLYLHRYWHFEQLVANKLLHAAQSVAPAAVMPSVLNTLFPRTYTYLYQALQQLKKGPSST
SDAGDSVERRQKEVCDKLDVVQANELDWQAIDVALTSANKAEELSVLDDLVPQSVCLNWQ
KVAAAMAITRQFSVISGGPGTGKTTTVAKLLAALVMQADDANSGENVITPNIKLVAPTGK
AAARLTESIGLAVQSLPVDPDVRLRIPTQSSTIHRLLGSVPNQVDFRHHRDNPLHLDVLV
VDEASMVDLPMMARLLDALPPHAKLILLGDRDQLASVEAGAVLGDICAFARQGYSPQQDQ
ILSQLTGFNVSGIRLGTHDDNSVSPIADSLCMLQKSYRFHAESGIGKLAKAINDGKPYDV
DRICQHDFKDINHYPLSAENYQKMINLTVTFYRDYLDAIEHKQEPEVVLKAFSSVRLLCA
LREGDFGVVGLNQRIERELVRIGKISQTDDTWYEGRPVMITRNDHSLGLYNGDIGIAMID
EKVDSNKPHLRVFFEMPDGSIRSVLPSRLPEHETVYAMTIHKSQGSEFADTLMVLPADFT
PILTRELIYTGVTRAKSRLYLFAQPDVIARAVRLRTERASGLARLLG
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
ttgatggagagcagatcgatgcttaagcgtttgcaagaactcacaaagcaaggtgcattg
cgtcagcttgattatcagtttgctaaattcgttgcgttgcgtagtcctgaatcgcattcc
tcattagtggctttgattaccgctcttgtcagtcatgaattaggtaaagggcacgtctgt
ttaatgctcaatgatctgaatactcaatcattatttggcttatctagccatgtgtcagtt
accttactcgatggtttaccagagcctaaacattgggaagctgagctaagtggtttatcg
gttatttcaaacatgacgcaaggtgaacagcatgccacaccgttagtactgcaagacggt
cgtttatatttacaccgttactggcattttgagcagctggtggcgaataaattgttgcat
gccgcacaatcggtagcgcctgccgctgttatgccatcggtactgaatacgctgtttcct
cgtacttatacctatttgtatcaagccttacagcagttaaaaaaagggccgtcatcaaca
tctgatgctggtgacagtgttgaacgtcgccagaaagaagtgtgtgataagttagatgtg
gttcaagctaatgagttggattggcaagcgattgatgtggcattaacttcggccaataaa
gcggaagagttatctgtattggatgatttggtgccacagtctgtgtgccttaactggcag
aaagtggctgctgcgatggcgattacgcgtcaattttcggttatatcaggtgggccgggt
accggtaaaacaaccactgtcgccaagttacttgctgcgttagtgatgcaagccgatgat
gctaatagcggtgaaaacgtcattacaccgaacattaagctagtagcgccgacagggaaa
gctgctgcccgtttgacagagtcgatcggtttagcggtacagtcgctacctgttgaccct
gatgtgcgtctgcgtatcccaacgcaatcaagtaccattcaccgcttattaggttcagtt
cctaatcaagttgattttcgtcatcatcgagataacccattacaccttgacgtgctggtg
gttgatgaagcatcgatggttgatttaccaatgatggcacgtttgcttgatgcattaccg
ccccatgctaaattgattctattaggtgaccgtgatcagctggcatctgttgaagcaggc
gctgtgctgggtgatatttgtgcttttgcccgtcagggatacagcccacagcaagatcaa
atactgagccaattaacagggtttaatgtctctggtattcgtcttggtacgcatgatgat
aatagtgttagccctattgcagacagcttatgcatgctgcaaaaaagttaccgttttcat
gccgagtcgggtatcggtaaattggcgaaagcgatcaatgatggaaaaccgtatgatgtt
gatagaatctgccaacacgatttcaaagacattaatcattacccattgagtgctgaaaac
taccagaagatgattaatctaacggtgaccttttaccgtgattatttagatgccattgaa
cataaacaagagccggaagtggtattaaaagccttttctagcgtacggttattatgtgca
ttacgggaaggtgattttggtgtggttggtttgaatcagcgtatagaacgtgaactggta
cgaattggaaaaataagccaaaccgatgatacttggtatgaaggtcgacctgtcatgatc
acccgaaatgatcatagtttagggctctataatggtgatattggcatcgccatgattgat
gaaaaagtcgactccaataaaccgcatctgcgtgtattttttgaaatgcctgatgggtct
attcgcagcgtattgccaagtcgattacctgaacatgaaaccgtgtatgcgatgacaatc
cataaatcgcaagggtctgaatttgctgacaccttgatggtattgcctgcagactttacg
cccattttaacgcgagagctgatttatactggcgttacacgagcgaaaagccgcctgtat
ttgtttgcccaaccagatgtgatagctcgggctgtaagattgcgaacggaaagagcaagt
ggattagcccgtttattaggatag

DBGET integrated database retrieval system