KEGG   Pan paniscus (bonobo): 100973483Help
Entry
100973483         CDS       T02283                                 

Gene name
HDAC10
Definition
histone deacetylase 10
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
pps  Pan paniscus (bonobo)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:pps05203]
Human Diseases; Substance dependence; Alcoholism [PATH:pps05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 669 aa AA seqDB search
MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRLSAREASEEEL
GLVHSPEYVSLVRETQVLGKEELQALSGQFDAIYFHPSTFHCARLAAGAGLQLVDAVLTG
AVQNGLALVRPPGHHSQRAAANGFCVFNNVAIAAAHAKQKHGLHRILVVDWDVHHGQGIQ
YLFEDDPSVLYFSWHRYEHGRFWPFLRESDADAVGRGQGLGFTVNLPWNQVGMGNADYVA
AFLHLLLPLAFEFDPELVLVSAGFDSAIGDPEGQMQATPECFAHLTQLLQVLAGGRVCAV
LEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMVPCQSALESIQSARAAQAPHWKSLQHQ
DVTAVPMSPSSHSPEGRPPPLLPGGPVCKAAASALSSLLDQPCLCPAPSVRTAVALTTPD
ITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIA
ATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALS
MFHVSTPLPVMTGGFLSCVLGLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGL
AGGRVLALLEEDSTPQLAGILARVLNGEAPPSLGPSSVASPEDVQALMYLRGQLEPQWKM
LQCHPHLVA
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggggaccgcgcttgtgtaccatgaggacatgacggccacccggctgctctgggacgac
cccgagtgcgagatcgagcgtcctgagcgcctgaccgcagccctggatcgcctgcggcag
cgcggcctggaacagaggtgtctgcggttgtcagcccgcgaggcctcggaagaggagctg
ggcctggtgcacagcccagagtatgtatccctggtcagggagacccaggtcctaggcaag
gaggagctgcaggcgctgtccggacagttcgacgccatctacttccacccgagtaccttt
cactgcgcgcggctggccgcaggggctggactgcagctggtggacgctgtgctcactgga
gctgtgcaaaatgggcttgccctggtgaggcctcccgggcaccacagccagagggcggct
gccaacgggttctgcgtgttcaacaacgtggccatagcagctgcacatgccaaacagaaa
cacgggctacacaggatcctcgtcgtggactgggatgtgcaccatggccaggggatccag
tatctctttgaggatgaccccagcgtcctttacttctcctggcaccgctatgagcatggg
cgcttctggcctttcctgcgagagtcagatgcagacgcggtggggcggggacagggcctc
ggcttcactgtcaacctgccctggaaccaggtcgggatgggaaacgctgactacgtggct
gccttcctgcacctgctgcttccactggcctttgagtttgaccctgagctggtgctggtc
tcggcaggatttgactcagccatcggggaccctgaggggcaaatgcaggccacgccagag
tgcttcgcccacctcacacagctgctgcaggtgctggccggcggccgggtctgcgccgtg
ctggagggcggctaccacctggagtcactggcggagtcagtgtgcatgacagtacagacg
ctgctgggtgacccggccccacccctgtcagggccaatggtgccatgtcagagtgcccta
gagtccatccagagtgcccgtgctgcccaggccccgcactggaagagcctccagcatcaa
gatgtgaccgctgtgccgatgagccccagcagccactccccagaggggaggcctccacct
ctgctgcctgggggtccagtgtgtaaggcagctgcatctgcactgagctccctcctggac
cagccgtgcctctgccccgcaccctctgtccgcaccgctgttgccctgacaacgccggat
atcacattggttctgccccctgacgtcatccaacaggaagcgtcagccctgagggaggag
acagaagcctgggccaggccacacgagtccctggcccgggaggaggccctcactgcactt
gggaagctcctgtacctcttagatgggatgctggatgggcaggtgaacagtggtatagca
gccactccagcctctgctgcagcagccaccctggatgtggctgttcggagaggcctgtcc
cacggagcccagaggctgctgtgcgtggccctgggacagctggaccggcctccagacctc
gcccatgacgggaggagtctgtggctgaacatcaggggcaaggaggcggctgccctatcc
atgttccatgtctccacgccactgccagtgatgaccggtggtttcctgagctgcgtcttg
ggcttggtgctgcccctggcctatggcttccagcctgacctggtgctggtggcgctgggg
cctggccatggcctgcagggcccccacgctgcactcctggctgcaatgcttcgggggctg
gcagggggccgagtcctggccctcctggaggaggactccacaccccagctagcagggatc
ctggcccgggtgctgaatggagaggcacctcctagcctaggcccttcctctgtggcctcc
ccagaggacgtccaggccctgatgtacctgagagggcagctggagcctcagtggaagatg
ttgcagtgccatcctcacctggtggcttga

DBGET integrated database retrieval system