KEGG   Pseudomonas putida W619: PputW619_4150Help
Entry
PputW619_4150     CDS       T00675                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ppw  Pseudomonas putida W619
Brite
Enzymes [BR:ppw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PputW619_4150
Secretion system [BR:ppw02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PputW619_4150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4576963..4577724)
Genome map
AA seq 253 aa AA seqDB search
MRVTQIFAAAALALASTFAVAAATDSNAAAEQAIRKSLQNLELEVPVESVASSPLNGLYE
VKLQGGRVLYASADGQFVMQGYLYQIQDGKPVNLTEKTERQGVAKLINGIPAAEMVVYPA
KGQTKSHITVFTDTTCPYCHKLHAEVPELNRRGIEVRYVAFPRQGLGSPGDEQLQAVWCS
SDRRAALDKMIDGKEIKAAKCANPVGKQFQLGQSIGVNGTPAIVLENGQVIPGYQPAPQV
AKLALAGQQQAAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccagattttcgccgccgccgcgttggcgctggccagtacctttgccgtt
gctgcggcgaccgacagcaatgccgctgccgagcaggcgattcgcaagtcgttgcagaac
cttgagctggaagtgccggtcgagagcgtggccagcagcccgctcaacggcctgtatgaa
gtcaagctgcagggcggccgtgtgctgtacgccagcgccgatggccagttcgtgatgcag
ggctacctgtaccagatccaggacggcaagccggtaaacctgaccgagaagaccgagcgc
caaggcgtagccaagctcatcaatggcattccagccgccgagatggtggtttatcctgcc
aagggccagaccaagtcgcacatcaccgtgttcaccgacaccacctgcccgtattgccac
aagctgcacgccgaagtgccagagctcaaccgtcgcggtatcgaagtgcgctatgtcgcc
ttcccgcgccagggcctcggctcgccgggtgacgagcagttgcaggccgtgtggtgctcc
agtgaccgccgcgcagcgctggacaagatgatcgacggcaaggaaatcaaggctgccaaa
tgcgccaacccggtcggtaagcagttccagctgggccagtcgatcggcgttaacggcacg
ccggcgatcgtgctcgaaaacggccaggtgattccaggttaccaaccggcaccgcaagtg
gccaaactggccctggccggccagcagcaggccgccaagtaa

DBGET integrated database retrieval system