KEGG   Pseudomonas putida DOT-T1E: T1E_0628Help
Entry
T1E_0628          CDS       T02181                                 

Gene name
acsB
Definition
acetyl-coenzyme A synthetase 2
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ppx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppx00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppx00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ppx00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:ppx00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
708579..710513
Genome map
AA seq 644 aa AA seqDB search
MFDIRKYPQALAVSQSAALTPEDYRRLYRQSVEDPDTFWAEQAKRLDWIKPWSSVQQCDL
HTGKARWFDGAQLNVSYNCIDRHLAQRGEQTALLWEGDDPKDSKAITYRELHRQVCRLAN
AMKARGVKKGDRVCIYMPMIPEAAFAMLACTRIGAIHSVVFGGFSPDALRDRILDADCRT
VITADEGVRGGKRIPLKQNVDKALASCPAVSSVLVVRRTGGDVTWAEGRDLWYHEATKEA
GDDCPPEPMEAEDPLFILYTSGSTGKPKGVLHTTGGYLLQATMTFKVVFDYRDGEVFWCT
ADVGWVTGHSYIVYGPLANGAISLMFEGVPNYPDTSRFWQVVDKHQVNIFYTAPTALRAL
MREGSAPLQSTSRKSLRLLGSVGEPINPEAWEWYFEEVGQKRCPIVDTWWQTETGGIMLT
PLPGTQSLKPGCATQPMFGVQPVLLDEKGKLIEGPGAGVLAIKASWPGQIRSVYGDHQRM
VDTYFKPLPGYYFTGDGARRDADGDYWITGRIDDVINVSGHRIGTAEVESALVLHDSVAE
AAVVGYPHDLKGQGVYAFVTTMNGVTPDDTLKAELLALVSKEIGSFAKPELIQWAPALPK
TRSGKIMRRILRKIACNELENLGDTSTLADPSVVQGLIDKRLNQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatatccgcaaatacccccaggccctggccgtcagccagtccgccgccctcacc
cccgaagactaccgccgcctctaccgccagtcggtcgaagacccagacaccttctgggcc
gaacaggccaaacgtctggactggatcaagccttggtcaagcgtgcagcaatgcgacctg
cataccggcaaggcccgctggttcgacggtgcgcaactcaacgtcagctacaactgcatc
gaccgtcatctggcccagcgcggcgagcaaacggccctgctgtgggaaggcgacgatccc
aaggactccaaggccatcacctaccgcgaactgcaccgtcaggtctgccgcctggccaat
gcaatgaaagcgcgcggtgtgaagaaaggcgaccgggtgtgcatctacatgccaatgatt
cccgaggccgccttcgccatgctcgcctgcacccgcatcggcgccatccactcggtagtg
ttcggcggtttctcccccgatgccttgcgagaccgtattctcgatgccgactgccgcacc
gtgatcaccgccgatgaaggcgtgcgtggcggtaaacgcatcccactgaaacagaacgtc
gacaaagccttggccagttgcccagcggtcagtagcgtattggtggtgcgccgcactggc
ggcgatgttacctgggccgagggccgcgacctctggtatcacgaagcgacgaaagaggcc
ggcgacgactgcccccctgaaccgatggaggccgaagacccgctgttcatcctctacacc
tccggcagcaccggcaaacccaaaggggtgctgcataccaccggcggctacctgctgcag
gcaacgatgaccttcaaggtggtgttcgattatcgtgacggcgaggtgttctggtgcacc
gccgatgtcggctgggtgaccggccacagctacatcgtctatggcccgctggccaatggc
gcaatctcgctgatgttcgaaggcgtgcccaactacccggatacctcgcgcttctggcag
gtggtggacaagcaccaggtgaacatcttctacaccgccccgaccgccctgcgcgcactg
atgcgtgagggctccgcgccactgcagagcacctcacgcaaaagcctgcgtctgctgggc
agcgtcggcgagccgatcaacccggaagcctgggaatggtacttcgaggaggtcgggcaa
aagcgctgcccgattgtggatacctggtggcagaccgaaaccggcggcatcatgctcacc
ccactgcccggcacacagtcactcaaacccggctgcgctacccagccaatgttcggcgtg
caaccggtgctcctggacgaaaaaggcaaactgatcgaaggccccggcgccggcgtgctg
gcgatcaaagccagctggccggggcagatccgcagtgtctacggcgaccaccagcggatg
gtcgacacctacttcaagcccttgcccggctactacttcacaggcgacggtgcccgccgc
gatgccgatggcgactactggatcaccgggcgcatcgacgatgtgatcaacgtatccggg
caccgcatcggcaccgctgaagtggaaagcgcacttgtgctgcatgacagcgtggccgaa
gccgcggtggtcggttatccccacgacctcaagggccaaggcgtctacgccttcgtcacg
accatgaatggcgtgacaccagatgacacgctgaaggccgagctactggccctggtcagc
aaggaaatcggcagcttcgccaagcctgagctgattcagtgggcgccagcgctacccaag
acgcgctcaggcaagatcatgcggcgtatactgcgcaaaatcgcctgcaatgagctggaa
aacctgggcgatacctcgaccctggccgacccaagcgtggtacagggcctgatcgacaaa
cgcctcaaccagtaa

DBGET integrated database retrieval system