KEGG   Pseudomonas putida DOT-T1E: T1E_0628Help
Entry
T1E_0628          CDS       T02181                                 

Gene name
acsB
Definition
(GenBank) Acetyl-coenzyme A synthetase 2
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00010  Glycolysis / Gluconeogenesis
ppx00620  Pyruvate metabolism
ppx00640  Propanoate metabolism
ppx00680  Methane metabolism
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01120  Microbial metabolism in diverse environments
ppx01130  Biosynthesis of antibiotics
ppx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T1E_0628 (acsB)
   00620 Pyruvate metabolism
    T1E_0628 (acsB)
   00640 Propanoate metabolism
    T1E_0628 (acsB)
  Energy metabolism
   00680 Methane metabolism
    T1E_0628 (acsB)
Enzymes [BR:ppx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     T1E_0628 (acsB)
Lipid biosynthesis proteins [BR:ppx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   T1E_0628 (acsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFO46486
UniProt: I7C099
Position
708579..710513
Genome map
AA seq 644 aa AA seqDB search
MFDIRKYPQALAVSQSAALTPEDYRRLYRQSVEDPDTFWAEQAKRLDWIKPWSSVQQCDL
HTGKARWFDGAQLNVSYNCIDRHLAQRGEQTALLWEGDDPKDSKAITYRELHRQVCRLAN
AMKARGVKKGDRVCIYMPMIPEAAFAMLACTRIGAIHSVVFGGFSPDALRDRILDADCRT
VITADEGVRGGKRIPLKQNVDKALASCPAVSSVLVVRRTGGDVTWAEGRDLWYHEATKEA
GDDCPPEPMEAEDPLFILYTSGSTGKPKGVLHTTGGYLLQATMTFKVVFDYRDGEVFWCT
ADVGWVTGHSYIVYGPLANGAISLMFEGVPNYPDTSRFWQVVDKHQVNIFYTAPTALRAL
MREGSAPLQSTSRKSLRLLGSVGEPINPEAWEWYFEEVGQKRCPIVDTWWQTETGGIMLT
PLPGTQSLKPGCATQPMFGVQPVLLDEKGKLIEGPGAGVLAIKASWPGQIRSVYGDHQRM
VDTYFKPLPGYYFTGDGARRDADGDYWITGRIDDVINVSGHRIGTAEVESALVLHDSVAE
AAVVGYPHDLKGQGVYAFVTTMNGVTPDDTLKAELLALVSKEIGSFAKPELIQWAPALPK
TRSGKIMRRILRKIACNELENLGDTSTLADPSVVQGLIDKRLNQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatatccgcaaatacccccaggccctggccgtcagccagtccgccgccctcacc
cccgaagactaccgccgcctctaccgccagtcggtcgaagacccagacaccttctgggcc
gaacaggccaaacgtctggactggatcaagccttggtcaagcgtgcagcaatgcgacctg
cataccggcaaggcccgctggttcgacggtgcgcaactcaacgtcagctacaactgcatc
gaccgtcatctggcccagcgcggcgagcaaacggccctgctgtgggaaggcgacgatccc
aaggactccaaggccatcacctaccgcgaactgcaccgtcaggtctgccgcctggccaat
gcaatgaaagcgcgcggtgtgaagaaaggcgaccgggtgtgcatctacatgccaatgatt
cccgaggccgccttcgccatgctcgcctgcacccgcatcggcgccatccactcggtagtg
ttcggcggtttctcccccgatgccttgcgagaccgtattctcgatgccgactgccgcacc
gtgatcaccgccgatgaaggcgtgcgtggcggtaaacgcatcccactgaaacagaacgtc
gacaaagccttggccagttgcccagcggtcagtagcgtattggtggtgcgccgcactggc
ggcgatgttacctgggccgagggccgcgacctctggtatcacgaagcgacgaaagaggcc
ggcgacgactgcccccctgaaccgatggaggccgaagacccgctgttcatcctctacacc
tccggcagcaccggcaaacccaaaggggtgctgcataccaccggcggctacctgctgcag
gcaacgatgaccttcaaggtggtgttcgattatcgtgacggcgaggtgttctggtgcacc
gccgatgtcggctgggtgaccggccacagctacatcgtctatggcccgctggccaatggc
gcaatctcgctgatgttcgaaggcgtgcccaactacccggatacctcgcgcttctggcag
gtggtggacaagcaccaggtgaacatcttctacaccgccccgaccgccctgcgcgcactg
atgcgtgagggctccgcgccactgcagagcacctcacgcaaaagcctgcgtctgctgggc
agcgtcggcgagccgatcaacccggaagcctgggaatggtacttcgaggaggtcgggcaa
aagcgctgcccgattgtggatacctggtggcagaccgaaaccggcggcatcatgctcacc
ccactgcccggcacacagtcactcaaacccggctgcgctacccagccaatgttcggcgtg
caaccggtgctcctggacgaaaaaggcaaactgatcgaaggccccggcgccggcgtgctg
gcgatcaaagccagctggccggggcagatccgcagtgtctacggcgaccaccagcggatg
gtcgacacctacttcaagcccttgcccggctactacttcacaggcgacggtgcccgccgc
gatgccgatggcgactactggatcaccgggcgcatcgacgatgtgatcaacgtatccggg
caccgcatcggcaccgctgaagtggaaagcgcacttgtgctgcatgacagcgtggccgaa
gccgcggtggtcggttatccccacgacctcaagggccaaggcgtctacgccttcgtcacg
accatgaatggcgtgacaccagatgacacgctgaaggccgagctactggccctggtcagc
aaggaaatcggcagcttcgccaagcctgagctgattcagtgggcgccagcgctacccaag
acgcgctcaggcaagatcatgcggcgtatactgcgcaaaatcgcctgcaatgagctggaa
aacctgggcgatacctcgaccctggccgacccaagcgtggtacagggcctgatcgacaaa
cgcctcaaccagtaa

DBGET integrated database retrieval system