KEGG   Pseudomonas putida DOT-T1E: T1E_0628Help
Entry
T1E_0628          CDS       T02181                                 

Gene name
acsB
Definition
acetyl-coenzyme A synthetase 2
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    T1E_0628 (acsB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T1E_0628 (acsB)
   00620 Pyruvate metabolism
    T1E_0628 (acsB)
   00640 Propanoate metabolism
    T1E_0628 (acsB)
  Energy metabolism
   00680 Methane metabolism
    T1E_0628 (acsB)
Enzymes [BR:ppx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     T1E_0628 (acsB)
Lipid biosynthesis proteins [BR:ppx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   T1E_0628 (acsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
708579..710513
Genome map
AA seq 644 aa AA seqDB search
MFDIRKYPQALAVSQSAALTPEDYRRLYRQSVEDPDTFWAEQAKRLDWIKPWSSVQQCDL
HTGKARWFDGAQLNVSYNCIDRHLAQRGEQTALLWEGDDPKDSKAITYRELHRQVCRLAN
AMKARGVKKGDRVCIYMPMIPEAAFAMLACTRIGAIHSVVFGGFSPDALRDRILDADCRT
VITADEGVRGGKRIPLKQNVDKALASCPAVSSVLVVRRTGGDVTWAEGRDLWYHEATKEA
GDDCPPEPMEAEDPLFILYTSGSTGKPKGVLHTTGGYLLQATMTFKVVFDYRDGEVFWCT
ADVGWVTGHSYIVYGPLANGAISLMFEGVPNYPDTSRFWQVVDKHQVNIFYTAPTALRAL
MREGSAPLQSTSRKSLRLLGSVGEPINPEAWEWYFEEVGQKRCPIVDTWWQTETGGIMLT
PLPGTQSLKPGCATQPMFGVQPVLLDEKGKLIEGPGAGVLAIKASWPGQIRSVYGDHQRM
VDTYFKPLPGYYFTGDGARRDADGDYWITGRIDDVINVSGHRIGTAEVESALVLHDSVAE
AAVVGYPHDLKGQGVYAFVTTMNGVTPDDTLKAELLALVSKEIGSFAKPELIQWAPALPK
TRSGKIMRRILRKIACNELENLGDTSTLADPSVVQGLIDKRLNQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatatccgcaaatacccccaggccctggccgtcagccagtccgccgccctcacc
cccgaagactaccgccgcctctaccgccagtcggtcgaagacccagacaccttctgggcc
gaacaggccaaacgtctggactggatcaagccttggtcaagcgtgcagcaatgcgacctg
cataccggcaaggcccgctggttcgacggtgcgcaactcaacgtcagctacaactgcatc
gaccgtcatctggcccagcgcggcgagcaaacggccctgctgtgggaaggcgacgatccc
aaggactccaaggccatcacctaccgcgaactgcaccgtcaggtctgccgcctggccaat
gcaatgaaagcgcgcggtgtgaagaaaggcgaccgggtgtgcatctacatgccaatgatt
cccgaggccgccttcgccatgctcgcctgcacccgcatcggcgccatccactcggtagtg
ttcggcggtttctcccccgatgccttgcgagaccgtattctcgatgccgactgccgcacc
gtgatcaccgccgatgaaggcgtgcgtggcggtaaacgcatcccactgaaacagaacgtc
gacaaagccttggccagttgcccagcggtcagtagcgtattggtggtgcgccgcactggc
ggcgatgttacctgggccgagggccgcgacctctggtatcacgaagcgacgaaagaggcc
ggcgacgactgcccccctgaaccgatggaggccgaagacccgctgttcatcctctacacc
tccggcagcaccggcaaacccaaaggggtgctgcataccaccggcggctacctgctgcag
gcaacgatgaccttcaaggtggtgttcgattatcgtgacggcgaggtgttctggtgcacc
gccgatgtcggctgggtgaccggccacagctacatcgtctatggcccgctggccaatggc
gcaatctcgctgatgttcgaaggcgtgcccaactacccggatacctcgcgcttctggcag
gtggtggacaagcaccaggtgaacatcttctacaccgccccgaccgccctgcgcgcactg
atgcgtgagggctccgcgccactgcagagcacctcacgcaaaagcctgcgtctgctgggc
agcgtcggcgagccgatcaacccggaagcctgggaatggtacttcgaggaggtcgggcaa
aagcgctgcccgattgtggatacctggtggcagaccgaaaccggcggcatcatgctcacc
ccactgcccggcacacagtcactcaaacccggctgcgctacccagccaatgttcggcgtg
caaccggtgctcctggacgaaaaaggcaaactgatcgaaggccccggcgccggcgtgctg
gcgatcaaagccagctggccggggcagatccgcagtgtctacggcgaccaccagcggatg
gtcgacacctacttcaagcccttgcccggctactacttcacaggcgacggtgcccgccgc
gatgccgatggcgactactggatcaccgggcgcatcgacgatgtgatcaacgtatccggg
caccgcatcggcaccgctgaagtggaaagcgcacttgtgctgcatgacagcgtggccgaa
gccgcggtggtcggttatccccacgacctcaagggccaaggcgtctacgccttcgtcacg
accatgaatggcgtgacaccagatgacacgctgaaggccgagctactggccctggtcagc
aaggaaatcggcagcttcgccaagcctgagctgattcagtgggcgccagcgctacccaag
acgcgctcaggcaagatcatgcggcgtatactgcgcaaaatcgcctgcaatgagctggaa
aacctgggcgatacctcgaccctggccgacccaagcgtggtacagggcctgatcgacaaa
cgcctcaaccagtaa

DBGET integrated database retrieval system