KEGG   Pseudomonas putida DOT-T1E: T1E_1220Help
Entry
T1E_1220          CDS       T02181                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    T1E_1220 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    T1E_1220 (nagZ)
Enzymes [BR:ppx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     T1E_1220 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1401385..1402395
Genome map
AA seq 336 aa AA seqDB search
MTVSLQGSLMVDIAGKWLTAEDRQLLRQPEVAGLIIFARNIDSPRQVRELCASIRAIRPE
LILAVDQEGGRVQRLRQGFVRLPAMRALADNDNAEYLAEQCGWLMATEVLAVGLDLSFAP
VLDLDHQRSAVVGSRAFEGDPLRATRLAGAFIRGMNAAGMAACGKHFPGHGWAEADSHVA
IPTDERSLEQLRQADLVPFTRLSGQLAAVMPAHVIYPQVDNQPAGFSRRWLQDILRGELG
FDGVIFSDDLSMAGAHVVGDAASRIEAALSAGCDMGLVCNDRAAAELALSAAQRMKVKPS
PRIARMRGQGFARTDYRQQPRWLEALGALKEAQLVD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcagcctgcaaggctccctgatggtggatatcgccggtaaatggctgaccgcc
gaagaccgtcaactgcttcgccagccggaagtggctggcctgatcatcttcgcccgcaat
atcgacagcccgcgccaggtgcgcgaactgtgcgcgtccatccgcgccattcgccccgag
ctgatcctggccgtggatcaggaaggtggtcgcgtacagcgtctgcgccagggctttgtg
cgcctgccggccatgcgtgcgctggccgataacgacaatgctgaatacctggctgaacag
tgcggctggctgatggcgaccgaggtactggcagttggcctggacctcagcttcgctccg
gtgctcgacctggaccaccagcgtagcgccgtggtgggcagccgcgccttcgagggtgac
ccgctgcgtgcaacgcgactggccggcgcgttcatccgaggcatgaatgcggcaggtatg
gccgcgtgtggcaagcatttcccggggcatggctgggccgaagccgattcgcacgtggcc
atccccaccgatgagcgcagcctggaacaactgcgccaggccgacctggtgccgtttacc
cgcctgagtgggcagctggcggcagtgatgccggcgcatgtcatctacccgcaggttgac
aaccagcccgctggcttctcgcggcgttggttgcaggacatcctgcgtggcgagctgggc
tttgatggggtgatcttcagtgatgacctgtcgatggccggtgcgcatgtggtgggcgac
gcggccagccgtatcgaggcggcgctgagcgccggttgtgatatgggcctggtgtgcaat
gaccgggcggcggcggagctggcgctgagtgcggcgcagcgcatgaaggtcaagccatcg
ccgcggattgcccggatgcgtgggcaagggtttgcgcggaccgattatcgccagcagccg
cgctggctggaggcgttgggggcgttgaaggaagctcagctggtcgattga

DBGET integrated database retrieval system