KEGG   Pseudomonas putida DOT-T1E: T1E_1220Help
Entry
T1E_1220          CDS       T02181                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppx00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ppx00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1401385..1402395
Genome map
AA seq 336 aa AA seqDB search
MTVSLQGSLMVDIAGKWLTAEDRQLLRQPEVAGLIIFARNIDSPRQVRELCASIRAIRPE
LILAVDQEGGRVQRLRQGFVRLPAMRALADNDNAEYLAEQCGWLMATEVLAVGLDLSFAP
VLDLDHQRSAVVGSRAFEGDPLRATRLAGAFIRGMNAAGMAACGKHFPGHGWAEADSHVA
IPTDERSLEQLRQADLVPFTRLSGQLAAVMPAHVIYPQVDNQPAGFSRRWLQDILRGELG
FDGVIFSDDLSMAGAHVVGDAASRIEAALSAGCDMGLVCNDRAAAELALSAAQRMKVKPS
PRIARMRGQGFARTDYRQQPRWLEALGALKEAQLVD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcagcctgcaaggctccctgatggtggatatcgccggtaaatggctgaccgcc
gaagaccgtcaactgcttcgccagccggaagtggctggcctgatcatcttcgcccgcaat
atcgacagcccgcgccaggtgcgcgaactgtgcgcgtccatccgcgccattcgccccgag
ctgatcctggccgtggatcaggaaggtggtcgcgtacagcgtctgcgccagggctttgtg
cgcctgccggccatgcgtgcgctggccgataacgacaatgctgaatacctggctgaacag
tgcggctggctgatggcgaccgaggtactggcagttggcctggacctcagcttcgctccg
gtgctcgacctggaccaccagcgtagcgccgtggtgggcagccgcgccttcgagggtgac
ccgctgcgtgcaacgcgactggccggcgcgttcatccgaggcatgaatgcggcaggtatg
gccgcgtgtggcaagcatttcccggggcatggctgggccgaagccgattcgcacgtggcc
atccccaccgatgagcgcagcctggaacaactgcgccaggccgacctggtgccgtttacc
cgcctgagtgggcagctggcggcagtgatgccggcgcatgtcatctacccgcaggttgac
aaccagcccgctggcttctcgcggcgttggttgcaggacatcctgcgtggcgagctgggc
tttgatggggtgatcttcagtgatgacctgtcgatggccggtgcgcatgtggtgggcgac
gcggccagccgtatcgaggcggcgctgagcgccggttgtgatatgggcctggtgtgcaat
gaccgggcggcggcggagctggcgctgagtgcggcgcagcgcatgaaggtcaagccatcg
ccgcggattgcccggatgcgtgggcaagggtttgcgcggaccgattatcgccagcagccg
cgctggctggaggcgttgggggcgttgaaggaagctcagctggtcgattga

DBGET integrated database retrieval system