KEGG   Paenibacillus sabinae: PSAB_01945Help
Entry
PSAB_01945        CDS       T03064                                 

Definition
class III aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
psab  Paenibacillus sabinae
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psab00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSAB_01945
   00650 Butanoate metabolism
    PSAB_01945
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSAB_01945
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSAB_01945
Enzymes [BR:psab01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PSAB_01945
Amino acid related enzymes [BR:psab01007]
 Aminotransferase (transaminase)
  Class III
   PSAB_01945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
433309..434619
Genome map
AA seq 436 aa AA seqDB search
MNEKEIIGREAVAAKRKQYFYPCTQHFYRNSPQLVRGSMQHVYDENGKKYTDFFAGVSVV
ACGHCNPAITERTIHQLQQLQHTTTIYLTQPNVDLAERLEKVLPGELRRTFFVNSGSEAN
EGAMLLARLHTGRKGFIALESGLHGRTNLTMSVTGLSMWRTDKYLDEDVTFIRRPYDPEL
TPAQAAERSLEDLKKVLEEKGDTIAAMIAEPIQGNGGMILPELSYFRSVKTLLDQYGVLL
IADEIQTGFGRTGTMFAMEHFGVVPDIITMAKALGNGVPVAAFATNDDIARSLNTPSAST
FGGNPVSAATALAVLDYIEAERLPERAERLGAKLREGLLDLQRSYPGTIADVRGAGLMLG
AELRAGGAAENAALTDEVLEEMKDRGYLIGKNGVGRNVLAFQPPLVITEEDIGGLLQALD
GTLARILAEAAPSADV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaggaaatcatcgggagagaggccgtcgcggccaagcgtaagcaatatttt
tatccttgtacacagcacttttaccggaattcgccgcagcttgtgcgcggatcaatgcag
catgtatatgacgagaacgggaaaaaatacaccgatttcttcgccggggtgtcggtggtc
gcctgcggccactgcaatccggcgattacggagcggaccattcaccagctgcagcagctg
cagcatacgacgaccatctatctgacccagccgaacgtcgatctggcggagcggctggag
aaggttcttcccggcgagcttagacgcacgttcttcgtgaacagcggctccgaggccaac
gagggagcgatgctgctggcacggcttcataccggccgtaaaggatttattgcgctggag
agcgggctgcacggccggaccaatctgacaatgagcgtaacagggctgtccatgtggcgg
accgataaatatctggacgaggatgtcacctttatccggcgtccctatgacccggagctg
acgccagcgcaggcggcggagcggtctcttgaggatttgaaaaaagtgcttgaagagaag
ggagatacgattgccgccatgatcgccgagccgattcagggcaacggcgggatgatcctg
ccggagctatcgtacttccgctcggtcaagacgctgcttgatcagtacggcgtcctgctg
attgccgacgagattcagaccggcttcgggcgcacgggcaccatgttcgccatggagcat
ttcggcgtagtgccggacatcatcacgatggcgaaggcgctcggcaacggcgtgccggta
gcggcctttgcgaccaatgacgacatcgcccgttccctgaacacgccgtccgcctccacc
ttcggcggaaatccggtatcggcggccacggcgctggccgtgctcgactacatcgaggcg
gagcggctccccgagcgggcggagcggctgggcgcgaagctgagggaagggcttctggac
cttcagcgcagttatccgggcacaatcgccgatgtgcggggagcgggccttatgctgggc
gccgagctgcgcgccggcggagcggcggaaaacgcggccttgacggatgaagtgctcgaa
gaaatgaaagaccggggatatttgatcggcaagaacggagtgggccgaaatgtcctggcc
ttccagccgccgctcgttatcaccgaagaagatatcggcgggctgcttcaggcgctggac
gggacactggcccgcattctggccgaagcggcgccttcggcggacgtgtag

DBGET integrated database retrieval system