KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4508Help
Entry
Psyr_4508         CDS       T00246                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Brite
Enzymes [BR:psb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Psyr_4508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5371848..5372960
Genome map
AA seq 370 aa AA seqDB search
MRRASRRSFLTAFVRLLACLPFVNSRLLAAETFTALRQPEAEKGIRFGFAVDPAKLNEDA
AYRELVARQASIVVPENALKWQTVHPEPERYNFAPADAIAAFAKAHDQRMRGHTFCWHRS
LPDWVHRTVTPTNAEAVLKAHISTVASHYRGLISTWDVVNEAIQLEDGQPDGLRNSFWYQ
MLGPRYLDIAFNAAHKADPDALLCYNDYGLEKDTHYGESRRTAVVALLRGLKQRGIPIHG
LGIQSHLRAGDTFGSGLSRFILAVRDMGLSIHITELDVDDSHLTGSIADRDGSVAATYKR
YLDVVLATRSVSTVITWGVWDSPHVAGATASNGPLAQRALAFGPRGEVKPASWVIAHCFE
NAQTQKDARF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgtgctagtcgacgcagttttctgactgcgtttgtccgcctgctggcgtgcctg
ccctttgtgaacagcaggctgctggcggcagaaacctttaccgcgttgcgccagcctgaa
gccgagaaaggcatacggttcggctttgcggttgatccggcaaagctgaatgaagacgcg
gcctaccgggaactggtcgcccgtcaggccagcatcgtagtgccagagaacgccttgaag
tggcagaccgtccaccccgaaccggagcgttacaacttcgcgcccgccgacgcgatcgcg
gcgtttgccaaagcgcatgaccagcgtatgcgcgggcacaccttctgctggcatcgttct
ttacccgactgggttcaccgtaccgtcacgccgacgaacgccgaggcggtgctgaaggcg
cacatcagtaccgtcgccagccattatcgtggcctcatcagcacatgggacgttgtcaac
gaagccatccagctggaggacggccagcctgacgggctgcgcaattcgttctggtatcag
atgctcgggcctcgctacctggacatagccttcaacgctgcgcacaaggccgacccggac
gccctgctctgctacaacgattacggcctggaaaaggatacccattacggcgaaagccga
cgcactgccgtcgtcgccctgctgcgcggtctcaagcagcggggcattccgatacacggc
ctgggcattcagtcccatctgcgtgcaggcgacacctttggttcgggcctgtctcgcttt
attctggcagtgcgggatatggggttgtcgatccacatcacggaactcgacgtcgatgac
agccacttgacggggtccatcgcagatcgcgatggatcagttgcagcgacttataagcgg
tatctcgacgtggtgcttgccacgcgctcggtgtctaccgttattacgtggggcgtttgg
gacagcccgcatgttgccggcgccacggccagcaacgggccgttggcacagcgggcatta
gcgtttggcccacgaggtgaggttaagccggcgagctgggtgatcgcacattgtttcgaa
aacgcgcaaacacagaaggatgcgcggttttag

DBGET integrated database retrieval system