KEGG   Pseudomonas stutzeri CCUG 29243: A458_00995Help
Entry
A458_00995        CDS       T02168                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
psc  Pseudomonas stutzeri CCUG 29243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
199718..201529
Genome map
AA seq 603 aa AA seqDB search
MSEEVERWKEKYLQLAERQEQLEARWEQRVDLLRRSLVRSSLAVEGADPAVERCLHEMRE
ILRDGDLDEGLSQLVPRLEKAVLESERHRQERAVRLTEALHRLVSQLLGMSVPAELRKPL
KRFAKELDQRAARLRELPVLLGELSDLQGQVLDLQGLAAPQQSGFLKRLFGGRDMPLAPP
AAERGEETPPSAAVNEVDAGPVVVEALGLPKPAVQAAPLLEDVPLAEAPADEEAIAETEA
EQNAAAYALPDSPEPAFSVVADRVEATLGSMLDSLHLPEQHQPQLQTLRARIQHGLNWYE
LVPVLDDLAMLMIAFSDQGQRDFENYLQTLNERLTAMQENLLAAHQGHNEGRDAAQALDA
ELREQVGGLQDSMRQAKDLTSLKQVVEARLDGLLTTVDTYRQQRSEQEQKLGERLQQLVS
RVGSLEQAARGLRGHLEEQRQKALQDPLTGLPNRAAWNERLELEFARWQRYGGDLLLAVL
DVDHFKRVNDGYGHLAGDRVLKIIGTELHKRLRKTDFIARFGGEEFVVLLPNTPYEAGLQ
LMESLRESIGSCPFHFKGERVAITLSAGLTAFSEGDSTERAFERADSALYRAKDSGRNRV
EAA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaagtcgaacgctggaaggaaaagtatcttcagctcgccgagcggcaggag
cagctcgaagcgcgctgggagcagcgggtcgatctgctgcggcgcagcctggtgcgtagc
agcctggcggtggagggtgccgatcccgcggtcgagcgctgcctgcacgaaatgcgagag
atcctccgcgacggcgatctggatgaggggctcagccagctggtgccgcgcctggagaag
gctgtgctggaatccgaacgccaccgccaggaacgggccgttcgcctgaccgaggctttg
catcggctggtctcccagctactgggcatgtcggtgccggcggagctgcgcaagccgctc
aagcgatttgccaaggagctggaccagcgtgccgccaggctgcgtgagctgccggtgctg
ctcggggagctgagtgacctgcagggccaggtgctggatctgcaggggctggcggcgccg
cagcagagcggttttctgaagcgactgtttggcgggcgggacatgccgctggcaccgcct
gcagccgagcggggtgaggaaaccccgccgtccgccgcagtcaatgaggtcgacgctggc
ccggtagtagtggaagcgctagggctgcccaagcctgccgttcaggctgccccgctgctc
gaggacgtgccgcttgccgaggcaccggccgacgaagaagctatcgctgaaaccgaggcg
gagcagaacgcggctgcgtatgccctgccggattcgccggagcccgcgttcagcgtcgtc
gcggaccgcgtggaggcgaccctcggcagcatgctggacagtcttcatctgccggaacag
caccagccgcaactgcagaccctgcgggcgcgcatccagcacggcttgaactggtatgag
ctggtgccggtgctggacgatctcgcgatgctgatgatcgccttcagcgaccagggccag
cgggatttcgaaaactacctgcaaacgctcaacgagcgcctgactgcgatgcaggaaaat
ctcctcgccgcgcaccaggggcataacgaaggacgcgacgccgctcaggcgctggatgcg
gagttgcgagaacaggtcggcgggttgcaggacagcatgcgccaggccaaggatctgacc
agcctgaagcaggtggtcgaggcgcgcctggatggcctgctgaccacggtggacacctac
cggcaacagcgtagcgagcaggaacagaagctcggtgagcgcctgcagcagttggtcagc
cgggtcggcagcctcgaacaggcagcacgcggcctgcgcgggcacctggaggagcagcgt
cagaaagcgctgcaggatccgctgaccggcctgcccaaccgggcggcatggaacgagcgc
ctggagctcgagttcgcccgctggcaacgttacggcggcgacctgctgctggccgtgctg
gacgtcgatcacttcaagcgggtcaacgatggctacggtcacctggctggtgatcgggtg
ctgaagatcattggcaccgagctgcacaagcgtttgcgcaagaccgatttcatcgcccgc
ttcggtggcgaggagttcgtcgtgctgctgcccaacacgccctatgaggcagggctgcag
ctgatggagtcgctgcgtgagtcgatcggcagctgtccgttccatttcaagggcgagcgc
gttgccatcacgctctcggccggcctgaccgcgttcagcgaaggtgacagcaccgagcgt
gccttcgagcgtgccgacagcgcgctctaccgggccaaggattcggggcgcaatcgcgtc
gaggcggcctga

DBGET integrated database retrieval system