KEGG   Pseudomonas stutzeri CCUG 29243: A458_00995Help
Entry
A458_00995        CDS       T02168                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Brite
Enzymes [BR:psc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     A458_00995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
199718..201529
Genome map
AA seq 603 aa AA seqDB search
MSEEVERWKEKYLQLAERQEQLEARWEQRVDLLRRSLVRSSLAVEGADPAVERCLHEMRE
ILRDGDLDEGLSQLVPRLEKAVLESERHRQERAVRLTEALHRLVSQLLGMSVPAELRKPL
KRFAKELDQRAARLRELPVLLGELSDLQGQVLDLQGLAAPQQSGFLKRLFGGRDMPLAPP
AAERGEETPPSAAVNEVDAGPVVVEALGLPKPAVQAAPLLEDVPLAEAPADEEAIAETEA
EQNAAAYALPDSPEPAFSVVADRVEATLGSMLDSLHLPEQHQPQLQTLRARIQHGLNWYE
LVPVLDDLAMLMIAFSDQGQRDFENYLQTLNERLTAMQENLLAAHQGHNEGRDAAQALDA
ELREQVGGLQDSMRQAKDLTSLKQVVEARLDGLLTTVDTYRQQRSEQEQKLGERLQQLVS
RVGSLEQAARGLRGHLEEQRQKALQDPLTGLPNRAAWNERLELEFARWQRYGGDLLLAVL
DVDHFKRVNDGYGHLAGDRVLKIIGTELHKRLRKTDFIARFGGEEFVVLLPNTPYEAGLQ
LMESLRESIGSCPFHFKGERVAITLSAGLTAFSEGDSTERAFERADSALYRAKDSGRNRV
EAA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaagtcgaacgctggaaggaaaagtatcttcagctcgccgagcggcaggag
cagctcgaagcgcgctgggagcagcgggtcgatctgctgcggcgcagcctggtgcgtagc
agcctggcggtggagggtgccgatcccgcggtcgagcgctgcctgcacgaaatgcgagag
atcctccgcgacggcgatctggatgaggggctcagccagctggtgccgcgcctggagaag
gctgtgctggaatccgaacgccaccgccaggaacgggccgttcgcctgaccgaggctttg
catcggctggtctcccagctactgggcatgtcggtgccggcggagctgcgcaagccgctc
aagcgatttgccaaggagctggaccagcgtgccgccaggctgcgtgagctgccggtgctg
ctcggggagctgagtgacctgcagggccaggtgctggatctgcaggggctggcggcgccg
cagcagagcggttttctgaagcgactgtttggcgggcgggacatgccgctggcaccgcct
gcagccgagcggggtgaggaaaccccgccgtccgccgcagtcaatgaggtcgacgctggc
ccggtagtagtggaagcgctagggctgcccaagcctgccgttcaggctgccccgctgctc
gaggacgtgccgcttgccgaggcaccggccgacgaagaagctatcgctgaaaccgaggcg
gagcagaacgcggctgcgtatgccctgccggattcgccggagcccgcgttcagcgtcgtc
gcggaccgcgtggaggcgaccctcggcagcatgctggacagtcttcatctgccggaacag
caccagccgcaactgcagaccctgcgggcgcgcatccagcacggcttgaactggtatgag
ctggtgccggtgctggacgatctcgcgatgctgatgatcgccttcagcgaccagggccag
cgggatttcgaaaactacctgcaaacgctcaacgagcgcctgactgcgatgcaggaaaat
ctcctcgccgcgcaccaggggcataacgaaggacgcgacgccgctcaggcgctggatgcg
gagttgcgagaacaggtcggcgggttgcaggacagcatgcgccaggccaaggatctgacc
agcctgaagcaggtggtcgaggcgcgcctggatggcctgctgaccacggtggacacctac
cggcaacagcgtagcgagcaggaacagaagctcggtgagcgcctgcagcagttggtcagc
cgggtcggcagcctcgaacaggcagcacgcggcctgcgcgggcacctggaggagcagcgt
cagaaagcgctgcaggatccgctgaccggcctgcccaaccgggcggcatggaacgagcgc
ctggagctcgagttcgcccgctggcaacgttacggcggcgacctgctgctggccgtgctg
gacgtcgatcacttcaagcgggtcaacgatggctacggtcacctggctggtgatcgggtg
ctgaagatcattggcaccgagctgcacaagcgtttgcgcaagaccgatttcatcgcccgc
ttcggtggcgaggagttcgtcgtgctgctgcccaacacgccctatgaggcagggctgcag
ctgatggagtcgctgcgtgagtcgatcggcagctgtccgttccatttcaagggcgagcgc
gttgccatcacgctctcggccggcctgaccgcgttcagcgaaggtgacagcaccgagcgt
gccttcgagcgtgccgacagcgcgctctaccgggccaaggattcggggcgcaatcgcgtc
gaggcggcctga

DBGET integrated database retrieval system