KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0929Help
Entry
NH8B_0929         CDS       T01619                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pse  Pseudogulbenkiania sp. NH8B
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(948295..950076)
Genome map
AA seq 593 aa AA seqDB search
MTTNNPIEVARETLKQLSTRKLLPTPENYERVYQELAKAPTERENKLATQLFRALESLPN
DNAAAKAMLQRLQLLIKASHWEQVPQLVIDFARQSQTTQQLAQEWGSLIENLIKSWDLRQ
TDFPQHFKQAGLERLLITYGKQPQELNKKLHSLIQTWNTPLRDREPLSEEILPSDETTAV
AELPPSWTVWQRILCFALKHGLEPRLQPYPELVLNLEAMIGEVEQLGDEATLNSLLPRLR
AFMIKVELYTQQEGRLVTGLSNLLKLLLDNIAEVNRSDSFMVGQIATLQEVLSQEPLSMQ
QIYQLETSLKEVIRKQGALKNSLDEAASSLRNLLDRFVSRLASMTDSTDEFHSKISTHST
RLRQIQNVEELTPIISSLMEDTSTMQLNLVRSRDELLSSREQVESAEQRIKELEIALEAA
SAKVKEDQLTGAYNRRGLAEHFQREISRAERTNSPLSVALIDVDNFKQLNDHYGHLTGDD
ALKHLVNVTRHTMRPSDIVARFGGEEFVILLPDTPPPEAIQAIQRLQRELTKTFFLANND
RLLITFSAGVAKWHLGERDTDVIERADQAMYQAKISGKNRVCSAEAEEAPPAA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaacaaccccatcgaagtcgcccgcgaaacgctgaaacaactcagcacccgc
aaactactgcccaccccggaaaattacgagcgcgtctaccaggagctcgccaaggctccg
acagagcgggaaaacaagctcgccacccagctgtttcgcgcgctggagagcctgcccaac
gacaacgctgccgccaaggcgatgttgcaacgcctgcaactgctcatcaaagcgtcccac
tgggagcaggttccgcaactggtgatcgattttgcccgacagagccagaccacccagcag
ctcgcccaggaatggggcagcctgatcgagaacctgatcaagagctgggatttgcgccag
accgatttcccgcagcacttcaagcaagccggactggaacggctgctgatcacctacggc
aaacagccgcaggaactcaacaagaaactgcattcgctgatccagacctggaataccccg
ttgcgggatcgcgagccgctctcggaggaaatactgccttccgacgagacaacggcggtc
gccgagctccccccgagctggacggtctggcagcgcatcctgtgctttgccttgaagcac
ggcctggagccgcgcctgcagccctaccccgagctggtgctcaatctcgaagccatgatc
ggcgaagtggagcaactcggcgacgaggccacgctcaacagcctgctgccgcggctgcgc
gccttcatgatcaaggtcgagctctacacccagcaggaagggcgcctggtcaccgggctg
tcgaacctgctcaaactgctgctcgacaatatcgccgaggtcaaccgctcggacagcttc
atggtcggtcagatcgccacgctgcaggaagtgctctcgcaagaacccttgtcgatgcag
cagatctaccagctggaaaccagcctgaaggaagtcatccgcaagcagggtgcgctgaag
aactcgctcgacgaggccgccagctcgctgcgcaatctgctggatcgcttcgtgtcgcgg
ctggccagcatgaccgacagcaccgacgagttccacagcaagatcagcacgcacagcacg
cggctgagacagatccagaacgtcgaggaactcacccccatcatcagttcgctgatggag
gacacctcgacgatgcagcttaacctggtcaggtcgcgtgacgagctgctgtcctcccgc
gaacaggtggagtcggccgagcaacgcatcaaggaactggaaatcgccctggaggcggcc
agcgccaaggtgaaggaagaccagctgaccggcgcctacaaccggcgcggactggccgag
cacttccagcgcgagatcagccgcgccgaacgcaccaacagcccgttgtcggtggcgctg
atcgatgtcgacaacttcaagcagctcaacgaccactatggccacctgaccggcgacgac
gcgctgaagcacctggtcaacgtgacccgccacaccatgcgcccctccgacatcgtggcg
cgcttcggcggcgaagaatttgtcatcctgctgccggacacgcccccccccgaggccatc
caggccatccagcgcttgcagcgcgagctgaccaagaccttctttctcgccaataacgac
cgcctgctgattaccttcagcgccggggtagcgaaatggcatctgggcgagcgcgatacc
gacgtgattgaacgtgccgaccaggccatgtatcaggccaagatcagcggcaagaaccgg
gtctgctccgcggaagcggaagaagccccccctgctgcctga

DBGET integrated database retrieval system