KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2883Help
Entry
Pse7367_2883      CDS       T02369                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pse7367_2883
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pse7367_2883
   00052 Galactose metabolism
    Pse7367_2883
   00500 Starch and sucrose metabolism
    Pse7367_2883
   00520 Amino sugar and nucleotide sugar metabolism
    Pse7367_2883
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pse7367_2883
   00524 Butirosin and neomycin biosynthesis
    Pse7367_2883
Enzymes [BR:pseu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pse7367_2883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3634796..3635863
Genome map
AA seq 355 aa AA seqDB search
MGTKGLGMTTILAGDIGGTKTLLRLAEVEPEAIALNPLFERRYVSAEFDSLAAIVKVFLT
AATKIGQIDLTGANHPQVACFGIAGPTVDNRCALTNLSWQLDGDRMAAELEVAHIALIND
FAAIGHGVLGLAPKELYILQKGKKDPQAPIGVIGAGSGLGMGYLTWDGDAYKVHASEGGH
VEFAPRDQLEMDLLTYLWQRSTHISIERLVSGQGIVTLYQFLRDRGFGSDQVGLEKKLKD
WETGATITSPAAAISEAGLRGSDRRAEKTMQMFADAYAAVIGNLALTLIPRGGLYIAGGI
APKVLPLLQSPRFMQVLKDKGRLSRVLDQVPIQIVLNQEVGLLGATLHAASLLKS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttgggaactaaagggctaggcatgacaactattttggcgggggacattggcggcactaaa
acgctattgcggctagcagaggtggagccagaggcgatcgccctcaatcctctgtttgag
cgtcgctatgtaagcgctgaatttgatagtctagcggcgatcgtcaaggtctttctgact
gctgctactaagattggccagattgatctaactggtgcaaatcacccccaggtagcttgc
tttggcattgctgggccaacggttgacaatcgctgtgccctaaccaatctcagttggcaa
ctggatggcgatcgcatggccgctgaattagaggtggcgcatatagcgctgatcaatgat
tttgcggcgatcggtcatggcgtgctgggtttagcgccgaaagagctttatatccttcaa
aagggcaaaaaagatccgcaagcgccgatcggtgtgattggggctggttctggcctgggg
atgggttatctgacctgggatggcgatgcctataaggttcatgcctccgagggcggtcat
gtggaatttgcgccccgcgatcagcttgaaatggatctgcttacctatctatggcagcga
tcgacccatatttcaattgaacggcttgtctctggccaggggatcgtcacgctctatcag
tttttgcgcgatcgtggttttggcagcgatcaggtggggctagagaaaaaattaaaagac
tgggaaaccggagccacgatcacttcgccagcggcagcgatctccgaggcggggttgcgt
ggtagcgatcgccgtgctgaaaaaaccatgcagatgtttgccgatgcctacgcagcggtg
attggtaatctggcgctgactttgattccccgtggtggtttgtatattgcggggggaatt
gcgccgaaagttttacctcttctgcaatcgcctagatttatgcaggtgctcaaagataaa
gggcgattgagccgggtgctagatcaagtgccgattcaaatagttttaaatcaggaggtg
gggttattgggggcgacactccatgcagctagtttgcttaaaagctag

DBGET integrated database retrieval system