KEGG   Pseudovibrio sp. FO-BEG1: PSE_1380Help
Entry
PSE_1380          CDS       T01669                                 

Gene name
mlycd
Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:psf00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:psf00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1459657..1460919)
Genome map
AA seq 420 aa AA seqDB search
MSLLADLLSTLFDRRYVFMGKRDERPLTELCNALMSSQGDVSGAAIAHEILDGYATTDTE
GKRAFFEFLNSEMDIDPDQLESVVSSYKTERTEANYRKLVEAAEPKRQELARRLNQVPGA
THQLVHMRKDLLGFMKDKPNLARTDVDFRHLFNSWFNRGFLVLRPISWDSPAQILEKIIA
YEAVHAIDSWDDLRRRLQPEDRRCFAFFHPSLPDEPLIFVEVALTKGVPSSIQGVLAEER
DIVPVDEVDTAVFYSISNCQSGLAGVSFGNSLIKQVVQDLSRELSQLKTFVTLSPLPTFC
KWAKEQEIDIPQDDAALKELAAYYLLEGKRRGDMPYDPVARFHLYNGALVHDVHVGADTS
ENGKKQSAGVMVNYLYDLQKISQNHEVFANKKEIVASKRVQALAKAGVVPASSQPKSDVA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctggcagatttgctttctaccctttttgatcgtcgttatgtttttatgggt
aagcgggatgaacgtccccttaccgagctttgcaatgccttgatgagcagtcagggagat
gtttccggcgctgccatcgcccatgagattctggatggctacgccacaacagatactgag
gggaaacgggcgttttttgagtttctgaacagtgagatggatatagacccggaccagctg
gaaagcgttgtttcctcctataaaacagagcggacggaagcgaattatcgcaagctggtg
gaggctgcggaaccgaaacggcaggagctggcgcgacggcttaatcaggtgcccggagcg
actcatcagttggtgcatatgcgcaaggatctgctcggtttcatgaaagataaaccgaat
cttgcccgtacagatgtggacttccggcacttgtttaactcttggtttaaccggggtttt
ctggtgctaaggccgatcagctgggatagcccagcgcagattttagagaagatcatcgcc
tatgaggccgtgcatgccattgatagttgggatgatttacgccgccgcctgcaaccggag
gaccggcgctgctttgcgttcttccatccttcccttccggatgaaccgctgatctttgtt
gaggtggcgctgaccaagggcgtcccctcctccattcagggcgtgcttgctgaagagcgg
gatattgtgccggttgatgaagtggatacggcggtcttctactcgatctccaactgtcag
agcggactggcaggcgtttcctttggtaactcgttgatcaagcaggtggttcaggatctt
tcgcgggagctgagtcagttgaagacgtttgtcacactgtctcctctgcctaccttctgc
aagtgggccaaagagcaggagatcgacattccgcaggacgatgcagccctgaaggagctg
gcagcctactaccttcttgaaggcaaacgcagaggggatatgccttatgacccagtggcc
cgtttccatctatacaacggtgcgctggtgcatgatgtgcatgtgggtgcggacacctcc
gagaatggcaagaagcagtcggcgggtgtgatggtcaactatctgtatgacctacaaaag
atctcgcaaaaccacgaagtctttgcgaataaaaaggaaatcgtggcatccaagcgggtt
caggcgctggcgaaagccggtgtggtgccggcgtcctcccaaccgaagagcgatgttgcc
taa

DBGET integrated database retrieval system