KEGG   Pseudovibrio sp. FO-BEG1: PSE_4636Help
Entry
PSE_4636          CDS       T01669                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:psf00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5012625..5014124)
Genome map
AA seq 499 aa AA seqDB search
MTGWVLSIDQGTTSTRAIVFNDSFESVGVGQREFPQHFPHEGWVEHDPEDLWNTTVETCR
EALSEAGLAAEKIIGVGITNQRETTLIWDRKTGEPVYNAIVWQDRRTSAFCSTLKAAGHE
EMFTRKTGLLLDPYFSGTKVAWILDNVEGVRERAEAGELAFGTVDTWLIWRLTGGKSHVT
DATNASRTLLYNIGENRWDEELLALLNIPMSLLPEVKDCADEFGTITADLLGAELPIYGV
AGDQQAATVGQACFKQGMVKSTYGTGCFALLNTGEELVYSKNRLLSTIAYRLNGKTTYAL
EGSIFIAGAAVQWLRDGLKIIDNAAQTQLMAENADPESHVYLVPAFVGLGAPYWDPEARA
AIFGMTRSTGQDEIARAALESVGYQTVDLINSKSSDMGSPLNGDTVLRVDGGMVASDWTM
QFLADILGRPVDRPVVQETTALGVAWLAGMKAGVWPTMEEFSERWNLDRRFEPNMEAAER
EKRLSGWHDAVSRTRSQAS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacagggtgggtgctctccattgatcaggggacgacgtcaacgcgtgcgatcgttttt
aatgacagcttcgaaagtgtgggggttgggcagcgtgagtttccgcagcactttccgcat
gaaggttgggtagagcacgatcctgaagacctttggaatacgactgttgagacatgccgc
gaagcgctgtctgaagcaggtcttgctgctgaaaagatcatcggcgtgggcatcaccaac
cagcgtgagacgacgctgatctgggatcgcaaaaccggtgagccggtttataacgcgatt
gtctggcaggaccgccgcacatctgctttctgcagcacgctgaaagccgctggtcatgaa
gagatgttcacccgcaagactggcctgctgcttgatccatacttctccggcaccaaagtg
gcctggattttggacaatgtagaaggtgtgcgcgagcgggcggaagctggtgagctggcg
tttggtaccgttgatacctggctgatctggcgtttaaccggcgggaagtctcatgtgact
gacgcgaccaacgcgtcccgtacgcttctttataatattggtgagaaccgctgggatgaa
gagctgctggctctgctgaacattccgatgagccttctgccagaagtgaaagattgtgct
gatgaattcggtacgatcactgccgatctgctgggcgctgagctgccgatttacggtgtg
gcgggtgaccagcaggccgcgactgttgggcaggcgtgctttaagcagggcatggtgaag
tcaacttatggcaccggctgctttgcattgctgaacactggcgaagagctggtttattcc
aagaaccgactgctctccacgattgcctatcgtctgaatggcaagaccacctatgcgctg
gaaggctccatctttatagcgggtgctgccgtgcagtggctgcgcgatgggctgaagatc
atcgacaatgcagcgcagacacagctgatggctgaaaatgccgatccggaaagccatgtt
tatctggttccggcgtttgttggtctgggtgctccttattgggatcctgaagcacgggcg
gcgattttcggtatgacccgttccaccggtcaggatgaaattgcgcgagcagcactggaa
agcgtcggttaccagactgttgatctgatcaactccaagtcttccgacatgggctctccg
ctgaatggtgacaccgtgctgcgcgttgatggcggtatggttgcttctgactggaccatg
cagttccttgcggacattcttggccgtccggtggatcgtcctgttgttcaggaaaccact
gcacttggcgttgcatggcttgcgggcatgaaggctggtgtgtggccaaccatggaagag
ttctccgagcggtggaatctggatcgccgctttgagccgaacatggaagcggcagagcgt
gagaagcgactctccggttggcacgatgcggtctcccgcacacgatctcaggcgtcctaa

DBGET integrated database retrieval system