KEGG   Pseudomonas stutzeri RCH2: Psest_4081Help
Entry
Psest_4081        CDS       T02391                                 

Definition
(GenBank) L-glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00220  Arginine biosynthesis
psh00250  Alanine, aspartate and glutamate metabolism
psh00471  D-Glutamine and D-glutamate metabolism
psh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Psest_4081
   00220 Arginine biosynthesis
    Psest_4081
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Psest_4081
Enzymes [BR:psh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Psest_4081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Vps4_C
Motif
Other DBs
NCBI-ProteinID: AGA88551
UniProt: L0GRD5
Position
complement(4256772..4257680)
Genome map
AA seq 302 aa AA seqDB search
MQALLQEILDEVRPLLGQGRVASYIPALADVPAEQLGIAVCSADGEVFEAGDAQTPFSIQ
SISKVFSLVQAIGHRGESLWERLGHEPSGQPFNSLVQLEFERGRPRNPFINAGALVICDV
NQSRFATPELSMRDFVRHLSGNRQIVSDTRVAESEYQHRARNAAMAYLMQAFGNFHNDVE
AVLRSYFHHCALRMNCIDLARAFAFLAREGSCPQSGEVILAPRQAKQVNAIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIVAVVPGRFTVCVWSPELNAAGNSLIGMAALEALSQRIGWS
VF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccctgctgcaggagattctcgacgaggtgcgcccgctgctcgggcaggggcgc
gtggccagttacatcccggcgctggcggacgtcccggccgagcagctcggtatcgccgtg
tgcagtgccgatggcgaagtgttcgaggccggcgacgcgcaaacgccgttttcgatccag
agcatctccaaggtcttcagcctggtgcaggccatcggacaccgcggtgaatcactgtgg
gaacgcctcggccacgagccgtccggccagccgttcaattcgctggtgcagcttgagttc
gaacgcggccggccgcgcaatccgttcatcaacgccggtgcgctggtgatctgcgacgtc
aatcagtcgcgcttcgccacccctgaactgtcgatgcgcgatttcgtccggcatctgtcc
ggcaaccggcagatcgtctcggacacacgcgttgccgagtccgaataccagcaccgtgca
cgcaacgccgccatggcttacctgatgcaggccttcggcaatttccacaacgacgtggag
gcggtgctgcgcagctactttcatcattgtgcgctgcgcatgaactgcatcgacctggcc
cgggccttcgccttcctcgcccgcgagggcagctgcccgcagagcggtgaggtgatcctg
gcgccgcgtcaggccaagcaggtcaacgccatcatggccaccagcggtctgtacgacgag
gccggcaactttgcctaccgcgtcggcctgcccggcaagagcggcgttggtggcggcatc
gttgcggtggtgccggggcgcttcaccgtttgtgtgtggtcgccggagctgaacgctgcc
ggcaattcgctgatcggcatggccgcgctcgaggcgctttcgcagcgcatcggctggtcg
gtgttctga

DBGET integrated database retrieval system