KEGG   Providencia stuartii MRSN 2154: S70_20055Help
Entry
S70_20055         CDS       T02042                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    S70_20055 (ipk)
Enzymes [BR:psi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     S70_20055 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4178445..4179320)
Genome map
AA seq 291 aa AA seqDB search
MTLTWPSPAKLNLFLYITGRRADGYHELQTLFQFLDYGDDITITTRADDHINLLTPMEGV
EPEQNLIVKAAKLLQHYCRDTLGYSEPLGADIKINKILPMGGGIGGGSSNAATTLIALNT
HWGTAVSDDVLAELGKSLGADVPVFVRGHAAFAEGIGEILTPASPKEKWYLVAHPGIEIS
TPMIFTDPQLNRNSPKRSLAALLLAPYANDCEPIARKRFREVEQLVSWLLEYAPSRLTGT
GACVFSEFETQADALKVLNKAPSWVHGFVAQGVNESPLHKFRAGITRVLHQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaacatggccttcccctgctaaattgaacctttttctctatatcacaggccgt
cgagcagacggctatcacgaattacaaacactgtttcaatttcttgattacggtgacgac
attaccatcaccacgcgggcagacgatcacatcaatctactcacgccaatggagggagta
gaaccagaacaaaacttaatcgtcaaagccgcaaaattattacaacactactgccgtgat
actttaggctattcagaacctctcggggcagatatcaaaatcaataaaatattgccaatg
ggcggcggtatcggtggaggctcttccaatgcggccaccacacttattgcattaaatact
cactggggaacagcagtgagtgatgacgtgttagcggagctaggtaaaagccttggagca
gacgttcccgtttttgtgcgaggccatgccgcttttgcggaaggaataggtgaaattttg
actccagcctcgcctaaagagaaatggtatctggttgcacatccaggaattgaaatctca
actccgatgatcttcacagatccgcaattaaatcgaaattctccaaaacgctcactagcc
gcattattactggctccgtacgcaaatgattgcgaaccaattgcaagaaaacgttttcgt
gaggttgaacagctcgtttcttggctgttagaatatgccccgtctcgccttacagggaca
ggtgcttgtgttttttctgaatttgaaacacaagcggatgcccttaaggtgttaaataaa
gccccatcgtgggtgcatggtttcgtcgctcaaggggtgaacgaatcgccgttgcacaaa
ttccgcgctgggataacccgtgtattgcaccaataa

DBGET integrated database retrieval system