KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_02120Help
Entry
PSJM300_02120     CDS       T02182                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase dihydrolipoyltransacetylase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00010  Glycolysis / Gluconeogenesis
psj00020  Citrate cycle (TCA cycle)
psj00620  Pyruvate metabolism
psj01100  Metabolic pathways
psj01110  Biosynthesis of secondary metabolites
psj01120  Microbial metabolism in diverse environments
psj01130  Biosynthesis of antibiotics
psj01200  Carbon metabolism
Module
psj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSJM300_02120 (aceF)
   00020 Citrate cycle (TCA cycle)
    PSJM300_02120 (aceF)
   00620 Pyruvate metabolism
    PSJM300_02120 (aceF)
Enzymes [BR:psj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSJM300_02120 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_D23 RnfC_N HlyD_3 CAT
Motif
Other DBs
NCBI-ProteinID: AFN76504
Position
complement(466774..468774)
Genome map
AA seq 666 aa AA seqDB search
MSETIRVPDIGSGEGEVIELFVKVGDRIEADQSILTLESDKASMEIPAPKAGVVKSLKVK
MGDRLKEGDELLELESEEAEASAAPADAAAEPAGAASGGPADETEAPTPPGDVNPSASAE
EGESQEIKVPDIGSSGKASVIEVSVKPGDSIEAEQALITLESDKASMEIPSPAAGVVESI
SVKVGDEVGTGDLILVLKGTAADKPAAAASAPAEQPKAQQSQAAAAPAAEEPAGEAVEEV
RIPDIGSSGAANVIEVMVKAGDSVEADQSLITLESDKASMEIPAPKAGVVESLSIKVGDE
AKTGDLILTLKVKGAAPAKKAEAPREEAVSQQQAVASNKQGVPEAKAAATPAPAVGGPSK
AGSKVHAGPAVRMTAREFGVDLAEVTGTGPKGRILKEDVQAYVKNVMNKAKQAPAEAATG
GAGIPPIPTVDFSRFGEIEEVAMTRLMQVGAANLHRSWLNVPHVTQFESADITELEAFRV
AQKAAAEKAGVKLTVLPLLLKACAHLLQELPDFNSSLAPSGKALIRKKYVHVGFAVDTPD
GLMVPVIRNVDQKSLLQLAGEAAALAEKARNKKLSADEMQGACFTISSLGHIGGTGFTPI
VNAPEVAILGVSKATMQPVWDGSAFQPRLMLPLSLSYDHRVINGAAAARFTKRLSELLAD
IRTMLL
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaaccatacgcgtacccgacatcggcagcggtgagggtgaagtaatcgagttg
ttcgtcaaggtcggcgaccgtatcgaagccgaccagagcatcctgacgctcgagtccgac
aaggccagcatggaaattcccgcgcccaaggcgggcgtggtgaagagcctgaaggtcaag
atgggtgatcgtctcaaggaaggcgacgagctcttagagctggaaagcgaggaagccgaa
gcatcggctgctccggctgacgcagccgccgagcctgccggcgccgccagcggtggcccg
gccgacgagaccgaggcgcctacgccgccgggtgatgtgaacccttcggcctcggccgag
gaaggcgagtcccaggagatcaaggtgccggacatcggctcctcgggcaaagccagcgtg
atcgaggtatcggtcaagcctggcgacagcatcgaggccgagcaggcgctgatcacgctc
gagtccgacaaggccagcatggaaatcccctctccggcggcaggtgtggtcgagagcatt
tcggtcaaggtgggcgacgaagtcggcaccggcgatctgattcttgtcctcaagggtacc
gctgccgacaagccggcggccgcggccagcgcaccggcggagcagcccaaggcgcagcaa
tcacaagccgccgcagcgccagctgccgaagagccggccggtgaagctgtggaagaagtc
cgcatcccggatatcggttccagcggtgccgccaacgtcatcgaagtgatggtcaaggcc
ggcgacagcgtcgaagcggaccagtccctgatcaccctggagtcggacaaggccagcatg
gagattccggctcccaaagcgggcgtggtggaatccctgtcgatcaaggtgggtgacgag
gccaagaccggcgacctgatcctgacgctgaaggtgaaaggcgctgcaccggcgaaaaaa
gccgaggcgccgcgcgaggaagcggtatcccagcagcaggccgtagcgtcgaacaagcag
ggcgtgccggaagccaaggccgcggctacgcctgcgccagctgtgggtggccccagcaag
gctggcagcaaggttcacgccggccctgcggtgcgcatgaccgcacgggaattcggcgtc
gatctggctgaggttaccggcaccggtcccaagggtcggattctcaaggaagacgtccag
gcttacgtcaagaacgtgatgaacaaggccaagcaggctcctgcggaagctgctacgggt
ggcgcgggaatcccgccgattccgaccgtcgacttcagccgattcggcgagatcgaggaa
gtggcaatgacccgcctgatgcaggtcggtgccgccaacctgcatcgcagctggctcaac
gtgccccacgtcacccagttcgagtcggccgacatcaccgagctggaagccttccgtgtg
gcgcagaaggccgcggcggaaaaggccggcgtcaagctgaccgtgctgccgctgctgctc
aaggcctgcgcccatctgctccaggaactgccggacttcaacagttcgctggcgcccagc
ggcaaggccctgatccgcaagaagtacgtgcatgtcggcttcgccgtggacacaccggac
ggcctgatggtgccggtcatccgcaacgtcgaccagaagagcctgctgcagctggctggc
gaagcggccgcactggcggagaaggcacgcaacaagaagctctcggccgacgagatgcag
ggtgcctgcttcaccatctccagcctcgggcacatcggcggcaccggcttcacgccgatc
gtcaacgccccggaagtggcgatcctgggtgtcagcaaggccaccatgcagccggtatgg
gacggctcagccttccagccgcgcctgatgctgccgctgtcactgtcctacgatcaccgc
gtgatcaacggggctgcggcggcgcgcttcaccaagcgcctgtcggagctgctggcggac
atccgcaccatgctgctgtaa

DBGET integrated database retrieval system