KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_13965Help
Entry
PSJM300_13965     CDS       T02182                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSJM300_13965
Enzymes [BR:psj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PSJM300_13965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3054381..3055571)
Genome map
AA seq 396 aa AA seqDB search
MNGPLQVTVLGATGSIGLSTLDVVARHPQHYQAFALTAFSRIAELRALCQRHAPRYAVVA
DAEQARVLQAQLLADGLQTRVLVGEGGLSEVAAHPEVDVVMAAIVGAAGLRPTLSAVQAD
KRVLLANKEALVMSGALFMQALRDSAAVLLPIDSEHNAIFQCLPGNYSNGLTKVGVRRIL
LTASGGPFRELPVERLAAVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAR
PDQVEVVVHPQSVIHSMVDYIDGSVLAQLGNPDMRTPIAHALAWPERIDSGVSPLDLLQI
GQLEFRAPDEQRFPCLRLARQAAEQCGTAPAMLNAANEIAVEAFLQGRIRFTEIASIIES
VLERQASVAVRCLEDVLAADEQARRLAMGWLDGHGC
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgaacggacccttacaggtaacggtactcggagcgacaggctccatcggcttgagcacg
ctggatgtcgtcgctcgccatccgcagcattaccaggcgttcgcgttgaccgccttcagc
cgtatcgccgaactgcgagcactctgccagcggcatgcgccgcgctatgccgtggttgcc
gacgccgagcaggcgcgcgtgttgcaggcgcaactgctcgctgatggcctgcagacgcgg
gtgctggtcggcgagggcgggttgagcgaagtcgccgcgcatcctgaagtggatgtggtg
atggcggccatcgtcggtgccgctgggttgcgcccgacgctgtcggcggtgcaggccgac
aagcgcgtgctgttggccaacaaggaagccctggtgatgtccggcgcgctgttcatgcag
gcgctgcgtgacagcgccgcggtattgctgccgatcgacagtgagcacaacgcgatcttc
cagtgcctgcccggcaactattccaacgggctgaccaaggtcggcgtgcgccgcattctg
ctgaccgcatccggtggtccgttccgtgagctccccgtcgagcgattggctgccgtgacg
cccgaacaggcctgtgcgcatccgaactggtcgatggggcgcaagatttcggtggactcg
gccagcatgatgaacaaggggctcgagctgatcgaggcctgctggctgttcgatgcgcgg
cccgatcaggtggaggtcgtcgttcacccgcagagcgtgatccattcgatggtcgactac
atcgacggctcggtgctggcgcagctgggcaatccggacatgcgcacgccgatcgcccat
gcgctggcatggcccgagcggatcgattccggtgtgtcgccgctggatctgctgcagatc
ggacagctcgaattccgcgcgcccgacgaacagcgctttccctgtctgcggctggcgcgg
caggccgcggaacaatgcgggacggcgccagcaatgctcaacgccgccaacgagatcgcc
gtcgaagcctttctgcaggggcgcatacgcttcaccgagatcgcgagtatcatcgagagc
gttctggagcggcaggcgtcggtcgcggtgcgctgcctggaggatgtgctcgccgccgac
gagcaggctcgccgcctggccatgggctggctggatggccacggttgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system