KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1630Help
Entry
PSTAA_1630        CDS       T01976                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PSTAA_1630 (glpK)
Enzymes [BR:psr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PSTAA_1630 (glpK)
Exosome [BR:psr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSTAA_1630 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1711449..1712957)
Genome map
AA seq 502 aa AA seqDB search
MSNQNKQFIVALDQGTTSSRAIVLDRNANVVTIAQREFAQIYPQPSWVEHDPMEIWATQS
GVFVEALAQAGITNEQVAAIGITNQRETAIVWDKITGRPIYNAIVWQSRQSTPICDQLKR
DGMEDHIRKTTGLVIDPYFSGTKIKWILDHIEGSRERARRGELLFGTVDCWLIWKMTQGK
AHVTDYTNASRTLLFDIHKLDWDPVMLEALDIPREMLPEVRSSSEVYGHAYIGSGQSTGI
PIAGIAGDQQAALFGQMCVEPGQAKNTYGTGCFLLMNTGTKAVQSEHGLLTTIACGPRGE
VNYALEGAIFNGGSTVQWLRDELKVLNESLDSEYFATKVPDSNGIYLVPAFTGLGAPYWD
PRARGALFGLTRGVKVDHLIRAALESIAYQTRDVLDAMQQDAGERLRALRVDGGAVANNF
LMQFQADLLGTQVERPQMKETTALGAAYLAGLATGFWSDLDELRSKSSIERVFEPACGSE
QREALYRGWQKAVERTRNWAED
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccagaacaagcaattcatcgtcgccctcgaccagggcaccaccagttcccgc
gccatcgtgctggaccgcaacgccaacgtggtgaccatcgcccagcgcgagttcgcgcag
atctacccgcaaccgagctgggtcgagcatgaccccatggaaatctgggcgacccagagc
ggcgtgttcgtcgaagccctggcccaggccggcatcaccaacgagcaggtggcggccatc
ggcatcaccaaccagcgcgagaccgccatcgtctgggacaagataaccggccgtccgatc
tacaacgccatcgtctggcagagccgccagagcacgccgatctgcgaccagctcaagcgc
gacggcatggaagaccacatccgcaagaccaccggcctggtgatcgacccctacttctcc
ggcaccaagatcaagtggattctcgatcacatcgaaggcagccgcgagcgcgctcgccgt
ggcgagctgctgttcggcaccgtcgactgctggctgatctggaagatgacccagggcaag
gcccacgtcaccgactacaccaacgcgtcgcgcacgctgctgttcgatatccacaagctg
gactgggacccggtgatgctcgaagcgctggacattccccgcgagatgctgccggaggtg
cgctcatcctcggaagtttacggccacgcctatatcggttccggccagagcaccggcatt
cccatcgcgggcattgccggcgatcagcaggccgcgctgttcggccagatgtgcgtcgaa
cccgggcaggccaagaacacctacggcaccggctgcttcctgctgatgaataccgggacc
aaggcagtgcagtccgaacatggtctgctgacgaccatcgcctgcgggccgcggggcgaa
gtgaattacgcgctggaaggcgccatcttcaatggcgggtccaccgtgcagtggctgcgt
gacgaactgaaggtgctcaacgaatcgctggattcggagtacttcgccaccaaggtgccg
gacagcaacggcatctacctcgtgccggcgttcaccggccttggcgcgccctactgggac
ccgcgtgcccgcggcgcactgttcggcctgacccgcggggtcaaggtcgatcatctgatc
cgtgctgcgctggaatccatcgcctaccagacccgcgacgtgctcgacgccatgcagcag
gatgccggcgagcgcctgcgcgctctgcgcgtggatggcggcgccgtggccaacaacttc
ctcatgcagttccaggccgacctgctcggcacccaggtcgaacgcccgcagatgaaggaa
accaccgccctcggtgcggcctacctggccgggctggcgaccggtttctggagtgacctc
gacgaattgcgcagcaagagcagcatcgagcgcgtgttcgaaccggcgtgcggaagcgaa
cagcgcgaagcgctctatcgcggctggcagaaggcggtcgagcgcacccgcaactgggcc
gaggactga

DBGET integrated database retrieval system