KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_2551Help
Entry
PSTAA_2551        CDS       T01976                                 

Gene name
glk-1
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSTAA_2551 (glk-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAA_2551 (glk-1)
   00052 Galactose metabolism
    PSTAA_2551 (glk-1)
   00500 Starch and sucrose metabolism
    PSTAA_2551 (glk-1)
   00520 Amino sugar and nucleotide sugar metabolism
    PSTAA_2551 (glk-1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSTAA_2551 (glk-1)
   00524 Butirosin and neomycin biosynthesis
    PSTAA_2551 (glk-1)
Enzymes [BR:psr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSTAA_2551 (glk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2742935..2743897)
Genome map
AA seq 320 aa AA seqDB search
MKTALVGDIGGTNARFALWRDQRIEQIRVLPTADHARPELAIRAYLDEVGQPLDALEAVC
LACAGPVGGDHFRFTNNHWQLSRQAFCRELGLKDLLLINDFTAMALGMTRLRDDERVTVR
EGEPEPGRPRLVIGPGTGLGVAGLLPLVGGGWRALPGEGGHICLPIGSEREAAIWTQLHR
AQGHVNAEAVLSGPGLLTLYRACCALDDRAAEHDSPAGITKAALAGEPYAVAVLEQFCRW
LGRIVGDNVLTLGARGGVYIVGGVVPRFAEFFMHSGFCDALCEKGQMSGYFDRLPVWLVT
APYPGLEGAGVALQSLLEGV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacagcgctggttggcgacatcgggggtaccaatgcacgcttcgcgctgtggcgc
gatcagcggatcgagcagattcgcgtgctgcccacggcagaccatgcgcgtccggagctg
gcaatccgcgcttaccttgacgaagtgggccagccgctggatgcgctggaagcggtatgc
ctggcttgtgccgggccggtgggcggcgatcacttccgcttcaccaacaaccactggcag
ctgagccgacaggcgttctgccgcgaactgggcctgaaggatctgctgctgatcaacgac
ttcaccgccatggccctgggtatgacccggctgcgcgatgacgagcgcgtcacggtccgc
gagggcgagcctgaacccggccggccgcgtctggtcataggccccggcaccgggttgggg
gttgccgggctgctgccgctggtgggcggcggctggcgcgcgttgccgggcgagggcggg
catatctgtctgccgatcggcagcgagcgcgaggcggcgatctggacgcaactgcaccgc
gcacagggccatgtgaatgccgaggcggtgctcagtgggccgggtttattgacgctctat
cgcgcctgttgcgcgctggatgaccgagcggccgaacacgactccccggccgggatcacc
aaggccgcgctggctggcgagccgtacgccgtggccgtgctggagcagttctgccgctgg
ctggggcgcatcgtcggcgacaacgtgctgacgctcggtgcacgcggcggggtatatatc
gtcggcggcgtggtaccgcgcttcgccgagttcttcatgcacagcggcttttgcgatgcc
ctgtgcgagaagggccaaatgagtggctatttcgatcgcctgccggtatggctggtgacc
gcgccttatccgggactggaaggcgccggcgtggcgttgcaatcgctgctggagggcgtc
tag

DBGET integrated database retrieval system