KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_2551Help
Entry
PSTAA_2551        CDS       T01976                                 

Gene name
glk-1
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00010  Glycolysis / Gluconeogenesis
psr00052  Galactose metabolism
psr00500  Starch and sucrose metabolism
psr00520  Amino sugar and nucleotide sugar metabolism
psr00521  Streptomycin biosynthesis
psr01100  Metabolic pathways
psr01110  Biosynthesis of secondary metabolites
psr01120  Microbial metabolism in diverse environments
psr01130  Biosynthesis of antibiotics
psr01200  Carbon metabolism
Module
psr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
psr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAA_2551 (glk-1)
   00052 Galactose metabolism
    PSTAA_2551 (glk-1)
   00500 Starch and sucrose metabolism
    PSTAA_2551 (glk-1)
   00520 Amino sugar and nucleotide sugar metabolism
    PSTAA_2551 (glk-1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSTAA_2551 (glk-1)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PSTAA_2551 (glk-1)
Enzymes [BR:psr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSTAA_2551 (glk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AEA84432
UniProt: F2N2C6
Position
complement(2742935..2743897)
Genome map
AA seq 320 aa AA seqDB search
MKTALVGDIGGTNARFALWRDQRIEQIRVLPTADHARPELAIRAYLDEVGQPLDALEAVC
LACAGPVGGDHFRFTNNHWQLSRQAFCRELGLKDLLLINDFTAMALGMTRLRDDERVTVR
EGEPEPGRPRLVIGPGTGLGVAGLLPLVGGGWRALPGEGGHICLPIGSEREAAIWTQLHR
AQGHVNAEAVLSGPGLLTLYRACCALDDRAAEHDSPAGITKAALAGEPYAVAVLEQFCRW
LGRIVGDNVLTLGARGGVYIVGGVVPRFAEFFMHSGFCDALCEKGQMSGYFDRLPVWLVT
APYPGLEGAGVALQSLLEGV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacagcgctggttggcgacatcgggggtaccaatgcacgcttcgcgctgtggcgc
gatcagcggatcgagcagattcgcgtgctgcccacggcagaccatgcgcgtccggagctg
gcaatccgcgcttaccttgacgaagtgggccagccgctggatgcgctggaagcggtatgc
ctggcttgtgccgggccggtgggcggcgatcacttccgcttcaccaacaaccactggcag
ctgagccgacaggcgttctgccgcgaactgggcctgaaggatctgctgctgatcaacgac
ttcaccgccatggccctgggtatgacccggctgcgcgatgacgagcgcgtcacggtccgc
gagggcgagcctgaacccggccggccgcgtctggtcataggccccggcaccgggttgggg
gttgccgggctgctgccgctggtgggcggcggctggcgcgcgttgccgggcgagggcggg
catatctgtctgccgatcggcagcgagcgcgaggcggcgatctggacgcaactgcaccgc
gcacagggccatgtgaatgccgaggcggtgctcagtgggccgggtttattgacgctctat
cgcgcctgttgcgcgctggatgaccgagcggccgaacacgactccccggccgggatcacc
aaggccgcgctggctggcgagccgtacgccgtggccgtgctggagcagttctgccgctgg
ctggggcgcatcgtcggcgacaacgtgctgacgctcggtgcacgcggcggggtatatatc
gtcggcggcgtggtaccgcgcttcgccgagttcttcatgcacagcggcttttgcgatgcc
ctgtgcgagaagggccaaatgagtggctatttcgatcgcctgccggtatggctggtgacc
gcgccttatccgggactggaaggcgccggcgtggcgttgcaatcgctgctggagggcgtc
tag

DBGET integrated database retrieval system