KEGG   Pseudoxanthomonas suwonensis: Psesu_2523Help
Entry
Psesu_2523        CDS       T01403                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psesu_2523
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psesu_2523
   00020 Citrate cycle (TCA cycle)
    Psesu_2523
   00620 Pyruvate metabolism
    Psesu_2523
Enzymes [BR:psu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Psesu_2523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2773432..2774820
Genome map
AA seq 462 aa AA seqDB search
MSQTKTFHLPDLGEGLPDATIVEWFVKEGDIIRLDEPLVSMETAKAVVEVPSPVSGKVLR
LAGKAGDVVVTGAMLAEFEPDASLPQRAEGHDTGHHHGAPAKPAKATASDDCGELPVQPA
PSEARGGDAGTVVGAMQSSDAVHAERAIAVGGVKAMPAVRALARKLGVDLARVPATGPDG
TVSLADVKQAAADPARLLPSTANTQGRTAQAPAPAAASAPAPSVQQRTPVSAAGRPMRTR
PPGADAGAAASGQPEQLKGVRRNMARVMADAHSKVVPTTLVDDADLHAWIGKQDITARLV
RAIVAACKAVPALNAWFDGEALAVTRHPHVDVGIAVDTDDGLFVPALRNADMLDANGIRA
GINRLRAQVEERSIAASELSGYTISLSNFGMFAGRYATPVVVPPCVAIVGAGKLSHDVVA
VMGGIEVHRRLPISLTFDHRAATGGEAARFLRALLDDMALPN
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaccaagaccttccacctgcccgacctgggcgagggcctgccggacgcgacc
atcgtcgagtggttcgtcaaggagggcgacatcatccgcctggacgagccgctggtctcg
atggagaccgccaaggcggtggtggaagtgccctcgccggtgtccggcaaggtcctgcgc
ctggccggcaaggccggcgacgtggtggtcaccggcgcgatgctggccgagttcgaaccc
gatgccagcctgccacagcgcgccgaaggccatgacaccggccaccaccacggcgccccg
gccaagcccgccaaggccaccgccagcgacgactgcggcgaactgccggtgcagccggcg
ccgtcggaagcgcgtggcggggacgccggcaccgtggtcggcgcgatgcagagctccgac
gccgtgcacgccgagcgtgcgattgcggtcggcggggtcaaggccatgcctgcggtacgt
gcactggcgcgcaagctgggcgtggacctggcccgcgtccccgccaccggtccggacggc
accgtcagcctcgccgacgtgaagcaggccgcggccgatcccgcgcgcctcctcccctcc
accgccaacacccagggtcggacggcgcaggcgccagctccggccgccgcttcggcgccc
gctccctccgtgcagcagcgcactcccgtctccgccgccggccgcccgatgcgtacccgt
ccgccgggcgccgacgccggtgccgccgccagcggccagcccgagcagctcaagggcgtg
cgccgcaacatggcgcgggtgatggccgatgcgcacagcaaggtcgtgccgaccaccctg
gtcgacgacgccgacctgcacgcctggatcggcaagcaggacatcaccgcgcgcctggtc
cgagcgatcgtggcagcgtgcaaggccgtgcccgcgctcaatgcctggttcgacggcgag
gcgctggcggtcacccgccatccgcacgtggacgtgggcatcgccgtggacaccgacgac
ggcctgttcgtgccggcgctgcgcaacgccgacatgctcgatgccaacggcatccgcgcc
ggcatcaaccgcctgcgcgcgcaggtcgaagagcgcagcatcgccgccagcgagctgtcc
ggctacaccatctcgctgtccaacttcggcatgttcgccggccgctacgccaccccggtg
gtggtgccgccgtgcgtggccatcgtcggcgccggcaagctcagccacgacgtggtcgcg
gtcatgggcggcatcgaagtccaccgccgcctgccgatctcgctgactttcgaccaccgc
gcagccaccggcggcgaagccgcccgcttcctgcgcgccctgctcgacgacatggccctg
ccgaactag

DBGET integrated database retrieval system