KEGG   Pyrenophora teres: PTT_08717Help
Entry
PTT_08717         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
pte  Pyrenophora teres
Brite
Protein kinases [BR:pte01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   PTT_08717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 2413 aa AA seqDB search
MTQQGPLSSALDRIVHELRSKNDETRQRAANTLRQTVEAAHRELAPNVFTNFNNEVYTKI
SGLIVTGSDSNERIGGIHALNALIDFRGDDAGQKTTRFASYLRAVMRGQDVTAMVVAAKA
LGRLAKPGGTLTAELVEAEVKGALEWLQLERLENRRFAAVLILRELAKNSPTLMYQWIAQ
IFEVIWVALRDPKVLIRESAAEAISACFEIISPRDSQMRQLWFGKVYDEILRGFTINTNE
AIHGSLLTMKELLDKSAMFMNDQKYKETVEQVLKYREHRDALVRREVVLIIPILAGYSPT
EFATKYLHQCMLHLQGLIRKDRDRDKAFVAIGQIANAVGVAISPYLEGILGFIQEGLIAK
SRNKSGINEAPIFQCLSMISAAVGQALTKSVERLLDPIFSCGLSDSLFQALVDMAHYVPP
SRPMIQEKLLDLLSQILAGRHFLPLGSPYQVSQPPQIWTRDHKDPQTIAPREAEIALALH
TLGSFDFTGHVLNEFVRDVAIRYVEADNPEIRKRAALTCCQLFVKDPIVHQTSTHATKVV
GDIIEKLLTVGVGDVDPDIRWDVLIALDARFDRHLGKADNVRTLFLALNDEVFGIREAAM
SIIGRLTAVNPAYVFPSLRKVLLQLLTEVNYANSPRSKEESAKLISSLVGAADSLIKPLI
DPIVEVLLPKCKDPNPEVASTTLKAIGDLATVGGEGMIKYIKDLMPVILDFMQDQTSDAK
RFSALKALGQLATNAGYVIEPYRDYPELMNILMSIVKTEPEGELRRETVRLMGTLGALDP
DEYQKIMEQSPDKHLILEAQAITDVSLIMQGITPSNEEYYPTIVISTLMGLLKDPSLVQY
HTAIVEAVMNIYATMGLKCVPFLNQVVPGFLHVIKSTPAGRSEGYFNQLSQLVRIVRQHI
RPYLPSILATIKEYWSSSPQLQATILSLIEAIARSLEGEFKVYLADVLPLMLSVLDSDQT
GKRLPSERVLHAFLIFGSSAEEYMHLIIPVMVKMFDKPGQPIQIRRHAIETLGRLSKQVN
VSEFAARIVHPLCRVLSGSEPTLKQTALETLCALIFQLGPDYIHFVPTVNKILIAHKVPH
ENYGRIVSKLQKGEPLPQDLSPDERYGEDDEDLNPAEILTKKLAVNQQHLKQAWEASNKT
TKEDWIEWMRRFSVELLRESPQQALRACTPLGSVYNPIARTLFNSAFVSCWTELYDQYQE
ELVRSIETALTSPNIPPEILQVLLNLAEFMEHDDKALPIDVRILGMYAGKCHAFAKALHY
KELEFNAEQNSSAVEALISINNQLQQTDAAFGILRKAQNYHDVELKETWFEKLQKWDEAL
AAYQRRELEEPDSFDVTMGKMRCLHALGEWDLLSSLSKEKWANATQEYRKAIAPLAATAA
WGLGKFADMDNYLGVMKEQSPDRAFFASILNIHNNRFEIAVEEIAKARKGLDTELSSLLG
ESYQRAYLPMIRVQMLAELEEIMQYKQNEGNLEKQKSMRKTWMKRLRGLQPNPEVWQRMI
KVRQLVISPQEGTDMWIKYTNLCRKSNRMNLANKALQKLLDIESTGDSTVVEFVRNNAHA
ISHPVAYTTYKYMWADQNHKQEALDSMKEFTGRLSEDLAMRTRAAANPMMGQNGMNGMSN
GQHMFNNMNPFATTNGHNGVNGMNGSAMLNGSAAGVSPSELVQCHRLLAKCYLKQGDWQQ
ELQDGEWEHEYVHEILAAYAAATRYNKDWYKAWHAWALANFEVINSITSKSDREATEVPN
NIIHDHVIPAIQGFFKSIALSSTSSLQDTLRLLTLWFGYGGREGVNRTITEGTKSVPIDT
WLEVIPQLLARINQPNAVVRQSIHQLLIEVGKAHPQALVFPLTVSMKSDVSRRQRSAKEL
MEAMREHSPKLVEQADLVSHELIRIAVLWHEQWHEGLEEASRLYFGDHNIDGMFATLAPL
HAMLDKGPETLREISFIQSFGRELQEARDWCNTFRTSGEIGDLNQAWDLYYQVFRKIARQ
LPSLMTLELQYVSPKLKDAHDLELAVPGTYQVGKPVIRIISFDPVASVIQSKQRPRKLEM
RGSDGKAHTHILKGHEDIRQDERVMQLFGLCNTLLSNDVESRKRHLNIQRYAAVPLSTQS
GLLGFVPNSDTLHVLIREYRDSRKILLNIEHRIMLQMAPDYDCLTLMQKVEVFGYALDNT
TGQDLYRVLWLKSKSSEAWLDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRITGKVI
HIDFGDCFEVAMHREKYPERVPFRLTRMLTYAMEVSNIEGSYRTTCEHVMRVLRSNKESV
MAVLEAFIHDPLLTWRLNHRDTSPVEPNYPSERRQSIMGEAANVPPEHQMSSIVGRPRHR
SSVAPPQNNDVDAKEVQNARALQVLSRVKEKLTGRDFGKGEDLPTEIQVDRLIKEATNLE
NLCQHYIGWCSFW
NT seq 7242 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaaggtcccctttcgtccgccctggaccgcatagtgcacgaactacgctca
aaaaatgacgagacacgacagcgagcagcaaatacactgcgacagacggttgaagcggcg
caccgagaactcgcgcccaacgtctttaccaatttcaacaatgaagtttacaccaagatc
tccggcctcattgtaacgggcagcgactccaacgaacgcatcggcggcatccacgcgctc
aacgccctgatcgacttccgcggcgacgatgcgggacagaagacgacgcgctttgcctca
tacctgagggccgtgatgcggggccaggatgtcacggccatggtggtagcagccaaggct
ctgggacgactggcgaagcccggtggcaccctcacggcagagctggtcgaggccgaggtc
aagggtgcgctggagtggctgcagttggagcgcctggagaatagacgcttcgctgctgtc
ctcatactacgcgagctggcgaaaaactcgcccacgctcatgtaccaatggattgcacaa
atcttcgaggtcatatgggtcgccctccgggaccccaaggttctcattcgagagtctgcc
gccgaggcaatcagcgcatgcttcgagatcatctccccacgcgactcgcaaatgcgccag
ctctggttcggcaaggtctacgacgagattctgcgcggattcaccatcaacaccaatgaa
gcgatccatggctcgctccttaccatgaaggaactgctcgacaagagcgcaatgttcatg
aatgaccaaaagtacaaagagactgttgagcaggtactcaagtaccgagagcatcgcgat
gctctggtccgaagagaagtggtgctcattatacctatactcgctggctattcgccaacc
gaattcgccacaaagtatctgcatcaatgcatgctacatctccagggtctaattaggaaa
gaccgtgaccgagacaaggcgttcgtagccattggacagattgcaaatgccgtcggcgtt
gccatctcaccctatctggaggggattctaggcttcatacaggagggcctgattgccaag
tcccggaataaaagcggtatcaacgaagcgcctatattccaatgtcttagtatgatatca
gcagcggtcggccaagccctcaccaagtctgtcgagcgactactggaccccattttctca
tgcggcttgagcgactctctcttccaagcacttgtagacatggcgcattacgtaccgcct
tcgcggccgatgattcaagaaaagctgcttgatctcctcagccagatccttgccggccga
cacttcttacccctaggcagtccatatcaggtatctcagcctccgcaaatatggacacgt
gaccacaaagatccgcaaaccatcgccccaagagaagctgagattgcactagccctgcac
acactcggtagtttcgacttcacaggccatgttctgaacgagttcgttcgcgatgttgcg
atccgatacgtagaggcggataaccccgagatccgcaaacgcgccgcgttaacttgctgc
cagctctttgtcaaggatcctattgtccaccagacaagtactcacgctacaaaagtggtt
ggggacatcatcgaaaaactgttgactgtcggtgtgggcgatgttgatcccgacataagg
tgggatgtcctaatagccttggatgctcggttcgaccgacatctcggcaaagcggacaat
gttcgtactctgttccttgcgctgaacgatgaggtattcggtattcgggaagctgccatg
tccatcattggtcgactgacagctgtgaatcctgcttatgtcttcccatcactccgcaaa
gtccttttgcagctactcaccgaggtcaactatgccaacagcccgcggagcaaggaagaa
agtgcaaagttaattagtagtcttgtcggtgctgctgacagtctcattaagccactgatc
gatccaatcgtcgaggtccttttgcccaagtgtaaggatccaaatcctgaagtcgcttca
acaacactcaaagccattggtgacctcgccacagtcggtggggagggcatgatcaaatac
atcaaggatctgatgcccgtcattctggacttcatgcaagatcagacgtcggatgctaag
cgcttctctgctctgaaagctctcgggcagctagctacgaacgctggctatgttatagag
ccgtacagagactacccggagctgatgaacattctcatgagcattgtgaagacagaaccg
gaaggtgaactccgaagggaaactgttagactcatgggtacccttggggctttagatccc
gacgagtatcagaagatcatggagcagtcgcccgacaagcatcttatcttggaagcgcag
gctatcacagatgtctcgctcatcatgcaaggcatcacgccctcaaacgaagagtattac
cccacaatcgtcatcagcacgctcatgggtctgttgaaagatccatccctggtccagtac
cacaccgctatcgtagaggctgttatgaacatttacgcgacaatgggcttgaagtgcgtg
cctttccttaatcaggtcgtgccaggtttcctccatgtcataaaatccacgccagcggga
cggtcggaaggctacttcaaccagctcagtcaactcgttcggatcgtgcgccaacacatt
cgcccttacttaccaagcatcctcgcaacgatcaaagagtactggagtagcagtccacag
ctccaagccacgattctttcattgatcgaggccattgctcgctcattggaaggcgaattc
aaggtctacttggctgatgtgctaccgctcatgctcagcgtacttgactctgatcagact
ggcaagcgcttaccttcagagagagtacttcacgcgttcctcatcttcggctcgagcgcc
gaagagtacatgcacctcatcattccagtcatggtcaagatgttcgataagcctggccag
cctatacaaatccggagacatgctatcgagactctaggacgtctgtcgaaacaagtcaat
gtctctgagtttgctgcgcgtattgtgcaccctctctgtcgagtgctttccggcagcgag
ccgacactgaagcagactgcactggagacactctgtgcactcatctttcagcttggtcca
gattacattcactttgtgcctactgtgaacaagattcttattgcgcacaaggtacctcat
gaaaactatgggcgcatcgtttcgaagttacagaagggcgaacccctaccccaagatctc
agcccagatgagcgttacggtgaagatgacgaagacttgaatcccgcagaaatcctcacc
aaaaagctagcggtcaaccagcagcatctcaagcaagcctgggaggcctcgaataaaacc
accaaagaagattggatcgaatggatgcgacgatttagtgtggaattgctgagagaatca
ccgcaacaagcactacgcgcttgcacaccactcggtagcgtgtataacccaatcgccaga
accttgttcaattctgcctttgtctcatgctggacagaactgtatgatcaataccaagag
gagcttgtgcgttccatcgagactgcacttacgtcgcccaatatcccgcctgagatattg
caagttctgctgaacctagcagagtttatggaacatgacgacaaggctctaccaatcgac
gtccggatacttggcatgtatgccggcaaatgtcatgcatttgccaaggcattacattat
aaggagctcgaattcaacgcggagcagaattccagtgctgtggaagcccttatcagtatc
aacaaccagctgcagcagactgatgctgccttcggtatcttgcgtaaggcgcaaaattac
catgacgttgagttgaaagagacttggtttgagaagttgcagaagtgggacgaggcgctt
gcagcgtaccagagacgtgagctcgaagagccagactctttcgacgtcactatgggtaaa
atgcgctgcttgcacgctctgggcgaatgggatcttctttccagcttgtccaaggagaag
tgggccaatgcgacacaagaataccgcaaggcgatagcaccgcttgccgccacggctgca
tggggtctgggtaagtttgctgacatggacaactaccttggtgtcatgaaggagcagtcg
cccgaccgtgcgttctttgcgtcgattctcaatattcacaacaaccgcttcgaaatcgcc
gtggaagagattgcgaaagctcgcaagggtctcgacacggaacttagttcgcttttggga
gagtcgtaccagcgtgcttacttaccaatgatccgtgtgcagatgttggcagaacttgag
gagattatgcagtacaagcaaaacgagggaaaccttgaaaagcagaagagcatgcggaag
acttggatgaagcgactcaggggactacagccgaatccggaagtttggcagcgcatgatc
aaggtgcgacagcttgttatctcaccacaagaaggaaccgacatgtggatcaagtatacc
aacctttgccgaaagagcaataggatgaacctcgcaaacaaggccctgcagaaactactg
gatatcgagagcacgggcgacagtactgtcgttgagtttgtacgcaacaacgcccacgcc
atctcgcaccccgttgcgtatacgacatacaagtacatgtgggcagaccagaaccataag
caggaggccctcgatagtatgaaggaattcaccgggcgactgtctgaggacctggctatg
cgaaccagggctgcggcaaaccctatgatgggccagaacggaatgaatggcatgtccaat
ggccagcacatgttcaacaacatgaatccttttgctaccaccaatgggcacaacggagtg
aatggtatgaatggctcagctatgttgaatggatcagccgcaggtgtctcaccgagcgaa
ctcgttcaatgtcaccgtctacttgccaaatgctacctcaagcagggagactggcagcaa
gagcttcaggacggcgaatgggaacacgagtatgtgcacgagatacttgccgcttacgcg
gcagctacacgttacaacaaggactggtacaaagcatggcatgcctgggcacttgccaac
ttcgaagtcatcaactcgattacgtccaagtctgacagggaggctactgaagtgcctaat
aacattatccacgatcacgtcatcccggctattcagggcttcttcaagtctatcgcgctg
tcttcaactagctcacttcaggacacactccgactgcttacgctgtggtttggttatggt
ggaagggagggggtcaatcgtaccattacagaaggaactaagtcagtacctatcgatacg
tggctcgaggttatcccgcaactcctcgctaggattaatcaaccaaacgccgtggttcga
cagtctatccatcagttgcttatcgaagtgggaaaggcacatcctcaggctttggtgttc
ccgttgacggtctcgatgaagtcggatgtatctcgacgccaacgatcggcaaaggagctc
atggaagcaatgcgcgagcattcgcccaaactagtcgagcaagccgatcttgtgagccac
gagctcattcgtatcgccgtactatggcacgaacaatggcacgagggcctcgaggaagcc
agcagactttactttggcgaccataacatagacggcatgttcgctacactcgcgcccctg
catgcaatgctcgacaagggaccagagacactacgtgagatttcgtttatccagtctttc
ggccgcgaactccaggaggctcgtgactggtgtaacacgtttaggacatctggcgagatt
ggcgacctcaaccaggcgtgggacctctactaccaggtgttccgcaagatcgctcgtcaa
ctgccgtccttgatgacgcttgagttgcaatatgtctcaccgaaactcaaggacgcccat
gaccttgagcttgctgttcccggaacgtaccaagttggcaagccggtgattcgaattata
tcattcgatccagtcgcatccgtgattcaatctaagcagcgacccaggaagctggagatg
cggggcagtgacggcaaggcacatacccatatcctcaagggacacgaagatatccgccaa
gatgaacgtgtcatgcaactctttggcctctgcaacacacttctttccaacgacgtagaa
tcacgtaagcgtcatctcaatattcaaagatatgccgctgttccgcttagcacgcagtct
ggtcttcttgggttcgttcctaacagcgacacactgcatgttctcattcgcgagtaccgc
gacagcaggaagattctcctcaacatcgaacatcgcatcatgctgcagatggcaccggat
tatgactgtctcacgcttatgcaaaaggtcgaagtgtttgggtacgcgctcgacaacacc
acgggccaagatctttaccgcgtcttgtggctcaagtccaagtcttcggaagcctggctt
gatcggcgtaccaactacacgcggtcgctggcagtcatgtcaatggtggggtatattctg
ggtcttggagatcgccatcccagtaacttgatgcttgaccgcatcaccggcaaggtcatt
cacattgatttcggagactgcttcgaagtagccatgcatcgagaaaagtatccggaacgt
gtgccgttccgattgacacgcatgttgacgtatgccatggaagttagtaacatcgagggc
agctaccggacaacttgtgaacatgtcatgcgggtgctgagaagcaacaaggagagtgtc
atggcagtgcttgaagcttttatacacgacccccttctgacgtggcgcctcaaccaccgt
gatacatctccggttgaaccaaactacccctcagaacgccggcaatccatcatgggcgag
gcggcgaacgttccgcccgaacatcaaatgtccagcatcgtcggccgtccccgtcaccgg
tcgtcggttgcgccgccgcaaaacaacgatgtcgatgccaaggaagtgcagaacgcgcgg
gcgttgcaggtgctgagcagggtcaaggagaagctcacaggccgagatttcggcaagggc
gaggacctgccaaccgagatacaggtcgataggcttatcaaagaggcgacgaatttggag
aatctgtgccagcattacattggctggtgtagtttctggtaa

DBGET integrated database retrieval system