KEGG   Paramecium tetraurelia: GSPATT00007353001Help
Entry
GSPATT00007353001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     GSPATT00007353001
Transcription machinery [BR:ptm03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     GSPATT00007353001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 387 aa AA seqDB search
MSQQFVGINGEQTGLGFTNRDQGAKVEEDQGLIDFKIITNDGTHGSMKMLIDLKNIFARQ
LPKMPKEYIVRLVFDRNHESMCIIKDNTKVIGGICYRKYPTQRFAEIAFLAITATLQVKG
YGTRLMNKFKEHIQKQDVEYLLTYADNYAIGYFRKQGFYQEIKMQPDRWKGFIKDYDGGT
LMECYVHPTIDYGNISDLIREQKQQMIDIIKKLTLNDRVYPGLDKQNYKADNSNSDKPTV
KPESIQGILESGWTIDDYNELKKQKEKTFMISCQQIIDTMRKHKSAWPFLDPVNKDDVPD
YYDVITDPIDIKTIEKKLQSNQYTSKDLFIKDVKRIFTNCRNYNQPDTIYYKCANELERS
IDDYLKKLKDEQQIPGVSKKIKKTSNK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaataatttgtgggaatcaatggtgaatagacaggtctaggattcacgaatcga
gatcaaggagccaaagttgaagaggatcaaggtttgattgacttcaaaataataaccaat
gatggaacccacgggagtatgaagatgctcattgatctcaagaacatttttgctagataa
ctacccaaaatgcccaaggagtacatcgtacgtttagtatttgatcgaaatcatgagtcc
atgtgtattattaaggacaacactaaagtaattggagggatctgttatcgaaagtatcca
actcaacgatttgctgagattgccttcttggccatcactgccacactctaagtaaagggt
tatggaactcgattgatgaacaaattcaaagagcatatccaaaaacaagatgttgaatat
ttgctaacttatgctgacaattatgccattgggtacttcagaaagcaaggattctattag
gaaatcaaaatgcaaccagatcgatggaaaggatttattaaagattatgatggaggcacc
ttaatggaatgttatgtacatccaactatagactacggaaatattagtgatttaattaga
gagtaaaagcagcaaatgatagatattattaagaaattgactttgaatgatagggtttac
cctggattagataagcagaattataaagctgataattccaattctgataaacctactgtc
aaacctgagagtatacaaggaatcttggaaagtggatggactatcgatgattataatgaa
ctcaaaaaacaaaaggaaaaaactttcatgatttcttgccaataaatcattgacaccatg
agaaaacataagtcagcctggcctttcttagatccagtcaacaaagatgatgtccctgat
tattatgatgttatcacagatcccattgacatcaaaactatcgaaaagaaattatagtct
aattaatatacatccaaagatctcttcattaaggatgtcaagaggatatttacaaactgt
agaaattacaatcaacctgatacaatttactacaaatgtgctaatgaattagaacgtagt
attgatgattatctgaagaaacttaaagatgaataacaaataccaggagttagtaagaaa
atcaaaaaaacaagcaataaatga

DBGET integrated database retrieval system