KEGG   Paramecium tetraurelia: GSPATT00011700001Help
Entry
GSPATT00011700001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ptm  Paramecium tetraurelia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 377 aa AA seqDB search
MSKKIKISQPLPKVNWKDSDMEEELTIKIPNANLISKIIDPRSSPQEYFVPIRFPAQQHM
KDADGFFIPLPKEDPKKKLQQQHQFQNERYQIQLQDLISIDDLGQGSSGRVIKALHRPTN
LLVALKTIQVVNDEKFTKQINLELETLVSCDHSNIIRCYGAFLEGAQVAIALEFMNLGTL
QDVIKKSGKIPEGMLGLIAYQLLKGLDYLHRTKKIIHRDIKPSNLLINSAGEVKISDFGV
SGQLLNTQDQRSTWVGTVTYMSPERFLCEPYSSNTDVWSLGLSLLECAWGVFPYPHPGTN
ETTPSLGFWEIKEYIVSRPAPPSPPEFSQMGADFIAMCLQKDPRKRRSAAELLEHPFIKQ
YEDVSLQYLEGWLNINQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaaattaaaatttcttaacctctaccaaaagtgaattggaaggatagtgat
atggaggaggaacttactatcaaaatacctaatgccaaccttattagcaaaatcattgac
ccaagatcgagtccctaggaatactttgttccaataagatttccagctcaataacacatg
aaagatgctgatggctttttcatacccttgcctaaagaagatccaaaaaaaaaattacag
caatagcatcaattctaaaatgaaagatactaaattcaattacaagacttgatatccatt
gatgatttaggtcaaggctcaagcggaagagtgatcaaagcattacatagaccaaccaat
ttacttgttgcccttaaaacaatacaagtagtgaatgacgagaagttcactaaataaatc
aatttggaactggaaactttggtcagctgcgatcattcaaacattatcagatgttatgga
gcttttctagaaggagcttaagtagccattgccttagaattcatgaatctaggcactttg
caagatgtgattaagaagtcaggaaaaatccctgaaggcatgttaggattaattgcctat
taacttcttaagggtttggactacttgcatcgaacaaagaaaatcatccatagagacatc
aagccttccaacttattgataaatagtgcaggcgaagtcaagatttccgactttggcgtg
agtggttaattactaaacacctaagatcagcgaagtacttgggttggcacggtgacttat
atgtcaccagaaaggtttctttgtgaaccctactcttctaatactgatgtctggtcttta
ggactttctttacttgaatgtgcttggggagtctttccttatcctcatcctggaaccaac
gaaacaactccttcccttgggttttgggaaatcaaagaatacattgtttctagacctgct
ccaccatcgcctcctgaattttcataaatgggggctgatttcatcgccatgtgtttacag
aaggatccaaggaagaggaggagtgctgcagaattgctggaacacccttttataaaacaa
tatgaagatgtgagtctgcaatatttagaaggttggcttaacattaattaatga

DBGET integrated database retrieval system