KEGG   Paramecium tetraurelia: GSPATT00019885001Help
Entry
GSPATT00019885001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
ptm  Paramecium tetraurelia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 541 aa AA seqDB search
MSDEIEPHILKRYEIVRKIGKGAYGVVWKAIDKRFKNTCVALKKIFDAFQNATDAQRTFR
EIMFLYELDHQNIIKLYNVHRAENNKDIYLVFEHMETDLHGVIRAGILEEVHKQYIIYQI
LKSIKYMHSAELLHRDLKPSNILLNSDCSVKVADFGLVRSVACRQDAPSPILTEYVATRW
YRAPEILLGSHTYTKGVDMWSVGCILGELLTGKPIFPGNSTLNQLDRILQLTGKPSTEDV
EAIQSPLASTMLEAINPPQVKPIHQLFPTASDDALDLIYRLLKFNPNKRLTAEKALSHPY
FSKFHNEVDEPSSEKIITLAIDDNQKFSANEYRDKLYEEIATRKRYSIRNQEDLNSQLHS
PPPVSDSNQIRERPQTQEVKSQQQQQDSAKLLDSAKQQDSAKCYDSAKQDPLKQRNSGRS
NSKQSKFVQSALTGLINPRKSSKPTKQSIQAQQQPNKTYAPSFPNTSSIAIQKNVSYTQT
EPKVISQQLYQQYYKLLNAAQDKLSVNQDSAQSQQKVKKGLSALLGSNQSLIRQSQNKQK
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgaaatcgaacctcatatattgaaaagatatgagatagttagaaagataggg
aagggtgcttatggagttgtatggaaggctatagacaaaagatttaagaatacatgtgtt
gcattgaaaaaaatatttgatgcattttaaaatgccacagatgctcaacgaacatttcgg
gagattatgttcctttacgaattggatcatcaaaatattatcaaactgtataatgttcat
agggcagaaaacaataaagatatatatttagtttttgaacacatggaaacagatttgcat
ggtgtaattagagcaggtatattggaagaagttcacaaataatacattatatatcaaata
ctgaagagcatcaagtatatgcactcagcggaattattgcatagagatttgaaaccttca
aatattctgttaaatagtgattgttctgttaaagttgctgattttggtttagtaagatca
gtagcatgtcgttaagatgccccttctccaatattgactgaatatgtggcaaccagatgg
tacagagctcctgagatattattgggatcccatacctacacaaaaggagtggatatgtgg
agtgtgggttgcattctaggggaattgctaacaggaaagccaatatttcctgggaattct
acattaaattagttagatcgtatattacaattgacaggcaaaccatcgactgaagatgtt
gaggcaatacagagtcccttggcctcgacaatgttagaggcaatcaatccaccataagtg
aagcccattcatcagttgttcccaactgcaagtgacgatgccttggatttaatatatcga
ttattgaaattcaatccaaacaaacgacttacagctgaaaaagctttgtctcatccctat
ttttcaaagtttcacaatgaagtagatgaaccatcatctgaaaaaataatcactttagcc
atcgatgacaattagaagttttcagcaaatgaatatagagacaaactatatgaagaaatt
gccactaggaagcgatatagtataagaaattaggaagatttgaattcttaattgcattct
cctccaccagtttctgattccaatcaaattagggagagaccataaactcaagaagtcaaa
tcacaataataacaataagacagtgctaaattattggattcagccaaacaataagattca
gctaagtgttatgattctgccaaataggatccacttaaataaaggaattcagggagatca
aattcgaaatagtccaaatttgtgtaatctgccttaactggactcatcaatcctaggaaa
agctccaaaccaacaaaacaatccatataagcttaataacaacctaataaaacttatgct
ccttcttttcctaatacatcatcaatcgcaatttagaagaatgtctcttatactcaaaca
gagcccaaagtgatatctcagcaactctattaataatattacaaattattgaatgctgcc
taggataaactttcagtcaattaagactctgcttaatcttaacaaaaggtcaaaaaagga
ctaagtgccttgttgggatcaaattaaagtttgattagacaatctcagaacaaacagaaa
aagtga

DBGET integrated database retrieval system