KEGG   Picrophilus torridus: PTO0085Help
Entry
PTO0085           CDS       T00177                                 

Definition
(GenBank) cytochrome P450
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
98333..99481
Genome map
AA seq 382 aa AA seqDB search
MYIPSYKEEPFEWYKSMRTQRIVREGNSVHVFKYNDVVTVLSNHNVFSSQFRDLLGDDIK
NELDSRAAPSILILDPPRHTELRGLVSSAFTPRKIESYDNYIRELAAKMIENIIEKRRCD
LVSEISYPLPIMVISNMLGVPEKDLKKFKEWSDALATSLGRGPDLRTQREMSEYFLNMID
RDSNDDNLISRLSNVSIDDKKLTDQEITGFSILLLVAGNETTTNLITNALIELSNHPDIY
KELVDNNKIAGDIVEETLRFRSPVQSTRRYAKYDYQINGFNIYKNDFIFLYLSSANRDEE
IFKDPDNFNPFRENKRHIAFGNGIHFCLGAPLARLESRIVLEEFAKRIESFSIERLNPDD
RIDSDIMYGYKRAIINVKKINQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtacattccatcttataaggaggagccattcgaatggtataaatcaatgaggacgcag
cggatagtaagggagggcaactcagttcatgtttttaaatacaatgacgttgtaacagta
ttatcaaatcataatgtattctcatcacagttccgtgacctgctcggcgatgatattaaa
aacgagcttgacagcagggccgcaccaagcatcctgatactcgatccaccaaggcacaca
gagcttagaggccttgtaagctcggcctttaccccaagaaagatagaatcatatgataat
tacataagagaacttgcagcgaaaatgatagaaaatattatagaaaagaggagatgcgat
ctcgtctcggagatatcgtatccattgcctatcatggttatatcaaacatgcttggcgtt
ccggaaaaggatctaaaaaaattcaaggaatggtcggatgcgcttgcaacatctcttgga
cgtggccctgatttaagaacccagagagagatgtcagaatacttcttgaatatgatagat
agagattcaaatgacgataatttaatatcaaggctttcaaatgtttcaatagatgataaa
aaactcacggatcaggagataactggattttcaatactattgctggttgccggaaacgag
acaacaacaaatttaataacaaacgctttaattgaactatcaaatcatccggatatctat
aaagaacttgttgataataataaaatcgcaggcgatattgttgaggaaacactaagattc
agatctcctgtgcagtcaacaagaagatatgcaaagtatgattatcagataaacggtttt
aatatatacaaaaatgactttatctttctttaccttagttctgccaacagggacgaggaa
atttttaaagatccggataattttaatccgttccgtgaaaacaaaaggcacatagctttt
ggtaatggaatacacttctgccttggtgcccctctggcaaggcttgaatcaagaatagtt
cttgaggagtttgcaaaacgcatagaatcatttagcatagaaagattaaatcccgatgat
agaatagacagcgatatcatgtacggctataaaagggcaataataaacgtaaaaaaaatt
aatcaataa

DBGET integrated database retrieval system