KEGG   Picrophilus torridus: PTO0085Help
Entry
PTO0085           CDS       T00177                                 

Definition
cytochrome P450 (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
pto  Picrophilus torridus
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    PTO0085
  Amino acid metabolism
   00380 Tryptophan metabolism
    PTO0085
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PTO0085
Enzymes [BR:pto01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     PTO0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
98333..99481
Genome map
AA seq 382 aa AA seqDB search
MYIPSYKEEPFEWYKSMRTQRIVREGNSVHVFKYNDVVTVLSNHNVFSSQFRDLLGDDIK
NELDSRAAPSILILDPPRHTELRGLVSSAFTPRKIESYDNYIRELAAKMIENIIEKRRCD
LVSEISYPLPIMVISNMLGVPEKDLKKFKEWSDALATSLGRGPDLRTQREMSEYFLNMID
RDSNDDNLISRLSNVSIDDKKLTDQEITGFSILLLVAGNETTTNLITNALIELSNHPDIY
KELVDNNKIAGDIVEETLRFRSPVQSTRRYAKYDYQINGFNIYKNDFIFLYLSSANRDEE
IFKDPDNFNPFRENKRHIAFGNGIHFCLGAPLARLESRIVLEEFAKRIESFSIERLNPDD
RIDSDIMYGYKRAIINVKKINQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtacattccatcttataaggaggagccattcgaatggtataaatcaatgaggacgcag
cggatagtaagggagggcaactcagttcatgtttttaaatacaatgacgttgtaacagta
ttatcaaatcataatgtattctcatcacagttccgtgacctgctcggcgatgatattaaa
aacgagcttgacagcagggccgcaccaagcatcctgatactcgatccaccaaggcacaca
gagcttagaggccttgtaagctcggcctttaccccaagaaagatagaatcatatgataat
tacataagagaacttgcagcgaaaatgatagaaaatattatagaaaagaggagatgcgat
ctcgtctcggagatatcgtatccattgcctatcatggttatatcaaacatgcttggcgtt
ccggaaaaggatctaaaaaaattcaaggaatggtcggatgcgcttgcaacatctcttgga
cgtggccctgatttaagaacccagagagagatgtcagaatacttcttgaatatgatagat
agagattcaaatgacgataatttaatatcaaggctttcaaatgtttcaatagatgataaa
aaactcacggatcaggagataactggattttcaatactattgctggttgccggaaacgag
acaacaacaaatttaataacaaacgctttaattgaactatcaaatcatccggatatctat
aaagaacttgttgataataataaaatcgcaggcgatattgttgaggaaacactaagattc
agatctcctgtgcagtcaacaagaagatatgcaaagtatgattatcagataaacggtttt
aatatatacaaaaatgactttatctttctttaccttagttctgccaacagggacgaggaa
atttttaaagatccggataattttaatccgttccgtgaaaacaaaaggcacatagctttt
ggtaatggaatacacttctgccttggtgcccctctggcaaggcttgaatcaagaatagtt
cttgaggagtttgcaaaacgcatagaatcatttagcatagaaagattaaatcccgatgat
agaatagacagcgatatcatgtacggctataaaagggcaataataaacgtaaaaaaaatt
aatcaataa

DBGET integrated database retrieval system