KEGG   Pan troglodytes (chimpanzee): 451393Help
Entry
451393            CDS       T01005                                 

Gene name
DHCR7
Definition
(RefSeq) 7-dehydrocholesterol reductase isoform X1
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00100  Steroid biosynthesis
ptr01100  Metabolic pathways
Module
ptr_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    451393 (DHCR7)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     451393 (DHCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24
Motif
Other DBs
NCBI-GeneID: 451393
NCBI-ProteinID: XP_001174211
Ensembl: ENSPTRG00000004013
UniProt: H2R2E7
Position
11
AA seq 475 aa AA seqDB search
MAAKSQPNIPKAKSLDGVTNDRTASQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMA
CDQYSCALTGPVVDIVTGHARLSDIWAKTPPITRKAAQLYTLWVTFQVLLYTSLPDFCHK
FLPGYVGGIQEGAVTPAGVVNKYQINGLQAWLLTHLLWFANAHLLSWFSPTIIFDNWIPL
LWCANILGYAVSTFAMVKGYFFPTSARDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFN
GRPGIVAWTLINLSFAAKQRELHGHVTNAMVLVNVLQAIYVIDFFWNETWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPHAVGVLLLGLVGYYIFRVANHQKDL
FRRTDGRCLIWGRKPKVIECSYTSADGQRHHSKLLVSGFWGVARHFNYVGDLMGSLAYCL
ACGGSHLLPYFYIIYMAILLTHRCLRDEHRCASKYGRDWERYTAAVPYRLLPGIF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaaatcgcaacccaacattcccaaagccaagagtctagatggcgtcaccaat
gacagaaccgcatctcaagggcagtggggccgtgcctgggaggtggactggttttcactg
gcaagcgtcatcttcctactgctgttcgcccccttcatcgtctactacttcatcatggct
tgtgaccaatacagctgcgccctgaccggccccgtggtggacatcgtcaccggacatgct
cggctctcggacatctgggccaagactccacctataacgaggaaagccgcccagctctat
accttgtgggtcaccttccaggtgcttctgtacacgtctctccctgacttctgccataag
tttctacccggctacgtaggaggcatccaggagggggccgtgactcctgcaggggttgtg
aacaagtatcagatcaacggcctgcaagcctggctcctcacgcacctgctctggtttgca
aacgctcatctcctgtcctggttctcacccaccatcatcttcgacaactggatcccactg
ctgtggtgtgccaacatccttggctatgccgtctccaccttcgccatggtcaagggctac
ttcttccccaccagcgccagagactgcaaattcacaggcaatttcttttacaactacatg
atgggcatcgagtttaaccctcggatcgggaagtggtttgacttcaagctgttcttcaat
gggcgccccgggatcgtcgcctggaccctcatcaacctgtccttcgcagcgaagcagcgg
gagctccacggccatgtgaccaatgccatggtcctggtcaacgtcctgcaggccatctac
gtgattgacttcttctggaacgaaacctggtacctgaagaccattgacatctgccatgac
cacttcgggtggtacctgggctggggcgactgtgtctggctgccttatctttacacgctg
cagggtctgtacttggtgtaccaccccgtgcagctgtccaccccgcacgccgtgggcgtc
ctgctgctgggcctggtgggctactacatcttccgggtggccaaccaccagaaggacctg
ttccgccgcacggatgggcgctgcctcatctggggcaggaagcccaaggtcatcgagtgc
tcctacacatccgccgatgggcagaggcaccacagcaagctgctggtgtcgggcttctgg
ggcgtggcccgccacttcaactatgtcggcgacctgatgggcagcctggcctactgcctg
gcctgcggcggcagccacctgctgccctacttctacatcatctacatggccatcctgctg
acccaccgctgcctccgggacgagcaccgctgtgccagcaagtacggccgggactgggag
cgctacaccgccgcagtgccttaccgcctgctgcctggaatcttctaa

DBGET integrated database retrieval system