KEGG   Pan troglodytes (chimpanzee): 737026Help
Entry
737026            CDS       T01005                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     737026 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 328 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSNVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRNA
DLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMK
HLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSE
PASPKRERPTSPAPHRPPKRVKAEAVPS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcggggctgtcgccgtacgcggacaagggcaagtgcggcctc
ccggagatcttcgaccccccggaggagctggagcggaaggtgtgggaactggcgaggctg
gtctggcagtcttccaatgtggtgttccacacgggtgccggcatcagcactgcctctggc
attcccgacttcaggggtccccacggagtctggaccatggaggagcgaggtctggccccc
aagttcgacaccacctttgagagcgcgcggcccacgcagacccatatggcgctggtgcag
ctggagcgcgtgggcctcctccgcttcctggtcagccagaacgtggacgggctccatgtg
cgctcaggcttccccagggacaaactggcagagcttcacgggaacatgtttgtggaagaa
tgtgccaagtgtaagacgcagtacgtccgggacacagtcgtgggcaccatgggcctgaag
gccacgggccggctctgcaccgtggctaaggcaagggggctgcgagcctgcaggaacgcc
gacctgtccatcacgctgggtacatcgctgcagatccggcccagcgggaacctgccgctg
gctaccaagcgccggggaggccgcctggtcatcgtcaacctgcagcccaccaagcacgac
cgccatgctgacctccgcatccatggctacgttgacgaggtcatgacccggctcatgaag
cacctggggctggagatccccgcctgggacggcccccgtgtgctggagagggcgctgcca
cccctgccccgcccgcccacccccaagctggagcccaaggaggaatctcccacccggatc
aacggctctatccccgccggccccaagcaggagccctgcgcccagcacaacggctcagag
cccgccagccccaaacgggagcggcccaccagccctgccccccacagaccccccaaaagg
gtgaaggccgaggcggtccccagctga

DBGET integrated database retrieval system