KEGG   Pan troglodytes (chimpanzee): 740768Help
Entry
740768            CDS       T01005                                 

Gene name
CES2
Definition
carboxylesterase 2
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    740768 (CES2)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     740768 (CES2)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     740768 (CES2)
    3.1.1.84  cocaine esterase
     740768 (CES2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 607 aa AA seqDB search
MTAQSRSPTTPTFPGPSQRTPPTPCPVQTPRLGKALIHGWTDPGQPLGEQQRVRRQRTET
SEPTMRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQ
TFLGIPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPAMCLQDLTPVKSEFLSQFNMTYPS
VSMSEDCLYLSIYTPAHSHEGSNLPVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQ
YRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSS
LVVSPISQGLFHGAIMESGVALLPGLIASSGDVISTVVANLSSCDQVDSEALVGCLRGKS
KEEILAINKPFKMIPGVVDGIFLPRHPQELLASADFQPVPSIVGVNNDEFGWVIPKVMRI
YDTQKEMDREASQAALQKMLTLMMLPPTFGDLLMEEYIGDNGDPQTLQAQFQEMMADYMF
VIPALQVAHFQCSRAPVYFYEFQHQPSWLKNIRPPHMKADHVKFTEEEEQLSRKMMKYWA
NFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKTLPQKIQELEEP
EERHTEL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcagtcccgctctcctaccacacccacctttcccggcccaagccagcgcacc
ccgccgactccctgcccagtccaaactccaaggctgggcaaggcactgatccacggctgg
accgacccggggcagcctctgggtgaacagcagcgtgtccgccggcagcgaaccgagacc
agcgagccgaccatgcggctgcacagacttcgtgcgcggctgagcgcggtggcctgtggg
cttctgctgcttcttgtccggggccagggccaggactctgccagtcccatccggaccaca
cacacagggcaggtgctggggagtcttgtccacgtgaagggcgccaatgccggggtccaa
accttcctgggaattccatttgccaagccacctctaggtccgctgcgatttgcaccccct
gagccccctgaatcttggagtggtgtgagggatggaaccacccatccagccatgtgtcta
caggacctcaccccagtgaagtcagagtttcttagccagttcaacatgacctacccttcc
gtctccatgtccgaggactgcctgtacctcagcatctacacgccggcccatagccatgaa
ggctctaacctgccggtgatggtgtggatccatggtggtgcgcttgtttttggcatggct
tccttgtatgatggttccatgctggccgccttggagaacgtggtggtggtcatcatccag
taccgcttgggtgtcctgggcttcttcagcactggagacaagcatgcaaccggcaactgg
ggctacctggaccaagtggctgcactacgctgggtccagcagaatatcgcccactttgga
ggcaaccctgaccgtgtcaccatttttggcgagtctgcgggtggcacgagtgtgtcttcg
cttgttgtgtcccccatatcccaaggacttttccacggagccatcatggagagtggcgtg
gccctcctgcctggcctcattgccagctcaggtgatgtcatctccacggtggtggccaac
ctgtcttcctgtgaccaagttgactctgaggccctggtgggctgcctgcggggcaagagt
aaagaggagattcttgcaattaacaagcctttcaagatgatccccggagtggtggatggg
atcttcctgcccaggcacccccaggagctgctggcctctgccgactttcaacctgtcccc
agcatcgttggtgtcaacaatgatgagtttggctgggtcatccccaaggtcatgaggatc
tatgatacccagaaggaaatggacagagaggcctcccaggctgctctgcagaaaatgtta
acgctgatgatgttgcctcctacatttggtgacctgctgatggaggagtacattggggac
aatggggatccccagaccctccaagcccagttccaagagatgatggcagactacatgttt
gtgatccctgcactccaagtagcacattttcagtgttcccgggcccctgtgtacttctac
gagttccagcatcagcccagctggctcaagaacatcaggccaccgcacatgaaagcagac
catgttaaattcactgaggaagaggagcagctaagcaggaagatgatgaagtactgggcc
aactttgcgcgaaatgggaaccccaatggcgagggtctgccacactggccgctgttcgac
caggaggagcaatacctgcagctgaacctacagcctgcggtgggccgggctctgaaggcc
cacaggctccagttctggaagaagacgctgccccaaaagatccaggagctcgaggagcct
gaagagagacacacagagctgtag

DBGET integrated database retrieval system