KEGG   Pusillimonas sp. T7-7: PT7_2461Help
Entry
PT7_2461          CDS       T01486                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00360  Phenylalanine metabolism
put00362  Benzoate degradation
put00620  Pyruvate metabolism
put00621  Dioxin degradation
put00622  Xylene degradation
put00650  Butanoate metabolism
put01100  Metabolic pathways
put01120  Microbial metabolism in diverse environments
put01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PT7_2461
   00650 Butanoate metabolism
    PT7_2461
  Amino acid metabolism
   00360 Phenylalanine metabolism
    PT7_2461
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PT7_2461
   00622 Xylene degradation
    PT7_2461
   00621 Dioxin degradation
    PT7_2461
Enzymes [BR:put01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PT7_2461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3 GFO_IDH_MocA CoA_binding Sacchrp_dh_NADP Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AEC21001
UniProt: F4GTN7
Position
complement(2626071..2626970)
Genome map
AA seq 299 aa AA seqDB search
MSAASQRVSVAILGSGNIGTDLLYKLKRHSLFDLVLVAGIDPDSEGLARARALGCATSAD
GIDAILETPGIQIVFEATSAKAHKLNAPRFREAGIMAIDLTPAKVGPSVVPCVNLTDEFD
LQNVNLISCAAQATVPIVYGVSRITEVSYAEIVATVASKSIGPGTRQNIEEFTNTTTRAL
EEVGGAARGKALVVVNPAEPPLLMRNTIYTVVGENVDEQAVKASVLDMVSQVQQYVPGYR
VTVEPFLRGDHFMTCVEVEGAGDYLPVYAGNLDIINAAAVAVAERYANVLAERQLTTQI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagcatcgcaacgtgtttccgttgccattcttggctcgggaaatatcggtacc
gaccttttatataagcttaaacgtcattccttgtttgatctggtgctggtcgcagggata
gaccctgattccgaaggccttgcgcgagcacgcgcactaggttgtgcgacctcggcagat
ggaattgatgcgatcttagaaaccccgggcattcagattgtttttgaagctacttctgcg
aaagcgcataaattgaacgcaccccgtttccgcgaggcagggatcatggcaattgatctg
actccagcgaaagtagggccaagcgtggttccttgcgtgaacctgaccgatgagttcgat
ttgcaaaacgtgaacttgatttcttgtgcggcccaggcaacagtgcccattgtttatggg
gttagccgaatcacggaagtgagttacgccgaaatcgttgcgacggtcgcgagtaagagt
ataggaccaggtactcgccaaaatatagaagagttcacgaacaccactacccgcgccctg
gaagaagtgggaggtgctgcacgaggaaaggcgttagtggtggtaaaccctgctgagcct
cctcttttgatgcgtaatacgatttataccgtggtaggggaaaatgtcgacgagcaggcc
gttaaagcttctgtgctggatatggtcagccaggtacagcagtatgtgccgggttatcgc
gtgacggttgaaccgtttctgcgcggagatcacttcatgacttgcgttgaggttgaaggg
gcaggcgactatttgccagtctatgctggaaatcttgacattattaacgctgctgctgtg
gcggtcgcagaacgctatgcaaatgtacttgcagagcgtcagcttaccactcaaatataa

DBGET integrated database retrieval system