KEGG   Pusillimonas sp. T7-7: PT7_2461Help
Entry
PT7_2461          CDS       T01486                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
put  Pusillimonas sp. T7-7
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:put00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:put00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:put00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:put00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:put00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2626071..2626970)
Genome map
AA seq 299 aa AA seqDB search
MSAASQRVSVAILGSGNIGTDLLYKLKRHSLFDLVLVAGIDPDSEGLARARALGCATSAD
GIDAILETPGIQIVFEATSAKAHKLNAPRFREAGIMAIDLTPAKVGPSVVPCVNLTDEFD
LQNVNLISCAAQATVPIVYGVSRITEVSYAEIVATVASKSIGPGTRQNIEEFTNTTTRAL
EEVGGAARGKALVVVNPAEPPLLMRNTIYTVVGENVDEQAVKASVLDMVSQVQQYVPGYR
VTVEPFLRGDHFMTCVEVEGAGDYLPVYAGNLDIINAAAVAVAERYANVLAERQLTTQI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagcatcgcaacgtgtttccgttgccattcttggctcgggaaatatcggtacc
gaccttttatataagcttaaacgtcattccttgtttgatctggtgctggtcgcagggata
gaccctgattccgaaggccttgcgcgagcacgcgcactaggttgtgcgacctcggcagat
ggaattgatgcgatcttagaaaccccgggcattcagattgtttttgaagctacttctgcg
aaagcgcataaattgaacgcaccccgtttccgcgaggcagggatcatggcaattgatctg
actccagcgaaagtagggccaagcgtggttccttgcgtgaacctgaccgatgagttcgat
ttgcaaaacgtgaacttgatttcttgtgcggcccaggcaacagtgcccattgtttatggg
gttagccgaatcacggaagtgagttacgccgaaatcgttgcgacggtcgcgagtaagagt
ataggaccaggtactcgccaaaatatagaagagttcacgaacaccactacccgcgccctg
gaagaagtgggaggtgctgcacgaggaaaggcgttagtggtggtaaaccctgctgagcct
cctcttttgatgcgtaatacgatttataccgtggtaggggaaaatgtcgacgagcaggcc
gttaaagcttctgtgctggatatggtcagccaggtacagcagtatgtgccgggttatcgc
gtgacggttgaaccgtttctgcgcggagatcacttcatgacttgcgttgaggttgaaggg
gcaggcgactatttgccagtctatgctggaaatcttgacattattaacgctgctgctgtg
gcggtcgcagaacgctatgcaaatgtacttgcagagcgtcagcttaccactcaaatataa

DBGET integrated database retrieval system