KEGG   Plasmodium vivax: PVX_099200Help
Entry
PVX_099200        CDS       T01073                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pvx  Plasmodium vivax
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PVX_099200
   01230 Biosynthesis of amino acids
    PVX_099200
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PVX_099200
   00030 Pentose phosphate pathway
    PVX_099200
   00051 Fructose and mannose metabolism
    PVX_099200
   00052 Galactose metabolism
    PVX_099200
Enzymes [BR:pvx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PVX_099200
Protein phosphatases and associated proteins [BR:pvx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PVX_099200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1421 aa AA seqDB search
MHNLNDNAGEGKKPSPDSLVKTMSVLLRDNECAFNMEEHEEQRSTDQGPSDKKDSEMIDC
LMQKLTSKKFLVEKETKNSFYLVDNENMKIKKLKEHGHSASLNDDLSPLQYERIKYQPTL
PKALASEYQLLEENHGDDFINKKDYEEIKQYLKNLHDMPILNVKETTNHESFKGGNVLKI
GIILSGGPAPGGHNVISGIYDYAKRYNEQSQVIGFLGGIDGLYSKNYVTVTDSLMNRFRN
LGGFNMLWSGRGKVRNKDDLIAIENIVAKLKLNGLVIIGGDGSNSNAALISEYFAERNIP
ISIIGIPKTIDGDLKSEAIEISFGFDTATKTYSEVIGNLCTDVKTGHNVYHVVRVMGRSA
SHVVLECALQTRPNIVLIGEEVEKEKLSLKDIVSNIVNTILKRRSLNKNYGVILIPEGLI
EFVPEIKVLIGELNVILKEGPFDADKLKHSREVWDFLPSIIRDQLLMDRESTGYIQVGKI
ATERLIIVLVESELAKLNDNSLNIQFMAHYLGYEGRCAIPSNFDCNYCYALGYNAALLID
HKKTGYMSIIQNLEDSYANWIPAAIPFLRIMHVNRDNTGKEFPAVKRYLVDLNSPLFNVL
KEVRSLWSLYDLYRAPGPIQFNGHLSNSRCYTVKIPTKDVLLCQNSDDLQLIISLANKTN
HLGSSNITGGAEDGGASQMDLSGKDADLQSKGGELGAVGATSTGAHEKSLSSYSPDAGQH
HSGTVAGKMITPPDMASEASINVDQVRNDFYEQHCSSYKSLGCMSELQTSRLYNKLELPE
LCSDLKAKVRAGKQYISNDPYTQKQILSNYPHMSYENKFQIQEIFHDKYATPISFEIKIG
IVFLSRQAPGAMNVLCGLYHRLKLLKGVCIAFYGLYGLLNNKYIIIDDDNIAKHLNQGGL
ELTGNSPEHSLFDKENRNKVCETVTNLQLNGLVMPGSNVTITEAALLAEYFLEKKIPTSV
VGIPLTGSNNLIHELIETCVGFDSSTKVYASLIGNVLTDAVSMPKYWHFIRLMGRSPSHE
VLECALQTHPNMVIISEEYGAADKTLWRVVQDIADVVCARAELGKNYGTVLIPDALLMHL
PHMKILLTEISDILNDANEKGQLVEARNDLVNLSTTQGAAAGTAGTAGTVAGAEQPLSAS
PWVLKLTPWSLALLKTFPQFIIKELLHVDLRSMRFEKLETEQLLLQMVKEELHQRKQKGK
YSGSFMGLTHFFGYQGRSSLPSEFDCKLAYSYGHAASIVIESGLTGYIVSIRGLCGNIKD
WKLFAIPFISLMKILPRGQGSKYLKSASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQME
DRFCNPGPIQFEGNASIYYNRILFEEQSEYFEMLRYVECYANILKDTCRFGVSADYLKNV
FVQLCGMLVLAYKPNDILSNMPYIGSIEDYYDWENQRKRMD
NT seq 4266 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacttgaacgacaacgccggagagggtaagaagccatccccggactccctcgtc
aaaacgatgtccgtgctgctaagggacaacgaatgcgctttcaatatggaagagcacgaa
gagcaacgaagcacagatcaaggaccgtcggacaaaaaagacagtgagatgattgactgt
ttgatgcaaaagctgacgtcgaaaaagttcctagtggaaaaggaaacgaagaactccttc
taccttgtagataacgaaaatatgaagataaaaaagttaaaggaacatggccattcggca
tcgctaaatgatgatttgagtcctctgcagtatgagaggataaagtaccaacccacatta
cccaaggcgttggcaagcgagtaccagctattggaagagaaccacggggatgattttatt
aacaaaaaggattatgaggagatcaaacagtatttgaagaacctgcacgatatgcccatt
ttgaacgtgaaggaaacgactaaccatgaatcttttaagggaggaaatgtgttaaaaatt
gggatcatcctctcaggtggtcccgccccaggtggccacaacgtcatatctggtatatat
gactatgctaagaggtacaacgagcagtcgcaggttattggctttttaggaggcatcgat
ggcttgtatagcaaaaactacgtcaccgttacggactcgttgatgaatcgatttaggaac
ttgggtgggttcaacatgctgtggtcaggccgagggaaggtgagaaataaagacgacttg
attgccatcgaaaatattgttgccaagttgaagctgaacgggttggtaataatcggaggg
gatggatccaacagtaacgcagcattgatttctgagtacttcgcggagaggaacattccc
atttctattattggcatcccgaagaccatcgatggggatttaaaaagtgaagcaattgaa
attagctttggattcgacaccgccacgaagacgtattcagaagtgataggcaatctgtgt
actgatgtgaagaccgggcataatgtataccacgtggtgagggtgatggggaggtccgcc
tcccatgtggtgttggagtgcgctctgcagacgaggccgaacatagtcctcataggggag
gaagtggagaaggagaagctatccctaaaggatatcgtaagcaacattgtgaataccatt
ttgaagagaaggtcgcttaacaaaaactacggagttattttaattcccgaggggttgatc
gaatttgtgcccgaaattaaggttttgattggcgagctgaacgtcattttgaaggaaggc
ccttttgatgcggataaattgaagcactccagagaggtgtgggatttcctgcccagtatc
attcgggaccagcttctaatggatagggaatccaccgggtatattcaagtgggcaaaatc
gcaacggagaggttaatcattgttctggtcgaatcggagctagccaaattgaatgacaac
agtttgaacattcagtttatggctcactatttagggtacgaggggaggtgtgccatcccg
tccaacttcgattgcaactattgctatgcgttggggtataatgccgctctgctaattgat
cataagaagacggggtacatgtctatcatacagaatttggaagattcgtatgcgaattgg
atccccgccgccattccgtttttgcgcatcatgcatgtgaatagggacaacacagggaag
gagttccccgctgtgaagaggtacctcgtcgatttgaacagcccccttttcaacgtgttg
aaagaagtccgtagtttgtggtccctctacgatttgtacagagcccctgggccgattcag
ttcaatgggcacttgagcaactccaggtgctacacggtgaagatacccacgaaggatgtg
ctgttgtgtcagaactcggacgacttgcagttgattatcagtttggcgaataagaccaac
catttaggaagcagcaacatcaccggaggtgcagaagatgggggggccagccagatggac
ttaagcggaaaagatgccgatttgcagagtaaggggggcgaacttggtgcggttggcgcc
acatcgacgggggcgcacgaaaagagcttatcctcttacagccccgatgcgggacaacac
cactctggaaccgtcgcagggaagatgattacccccccggacatggcgagcgaggcgagt
atcaacgtggatcaagtgagaaacgacttctacgaacagcactgctccagttacaagtcc
ctagggtgcatgtccgagttgcagacctccaggctgtataacaaattggagctgcctgaa
ctgtgctccgatttgaaggccaaagtgagggcaggaaaacagtacatatcgaatgacccc
tacacacagaagcagatcttgtccaattacccccacatgtcatatgaaaataaatttcaa
attcaggagattttccacgataagtatgccacgccgatctcgtttgaaataaaaatagga
attgtctttctgtctagacaggctcccggggcgatgaacgttctgtgtggtctgtaccac
cgactgaagcttctgaaaggggtgtgcattgccttttacgggttatatggcctcttaaat
aataagtacatcattatagacgacgacaatatagcgaagcatttgaaccagggaggattg
gagttgactggaaattccccggagcattccctatttgataaggagaaccgaaataaggtg
tgcgaaacggtcaccaatttgcagctcaacgggttggtgatgcctgggtccaatgtcacc
atcacggaagcggccctccttgcggagtacttcctggaaaagaagatccccacctccgtt
gtgggaattcctctaacgggttcgaataatttgattcacgagttgatagaaacgtgcgta
gggtttgacagcagcacgaaagtgtatgcctctctcattggaaatgtccttacagatgcg
gtgagcatgccgaagtattggcatttcattcgtctaatgggaagatctccttcgcatgaa
gtcctcgagtgcgccctgcagactcacccgaatatggtcatcatctcggaggagtatggg
gcggcggataagacgctctggagagtcgtccaagacattgcggacgtcgtctgtgcgagg
gccgagttgggaaagaactacgggacggtgttaatccccgatgcgctcctcatgcatctg
ccccatatgaagattctgctgaccgaaattagcgacatactgaacgacgccaatgagaag
gggcagctggtcgaggcgaggaacgacttggtgaatctctccaccacgcagggtgcggcg
gcgggtacggcgggtacagcgggtacagtggcgggagcggagcagcccctgtccgcttct
ccttgggtgctaaaactaaccccgtggagtttggccctgctgaagaccttcccccagttc
atcatcaaggagctcctgcacgtggatttgaggtccatgcggtttgaaaagctagagaca
gagcagctgctcctgcaaatggtgaaggaggaactgcatcagagaaagcaaaagggaaag
tactctggaagtttcatgggattgacccacttctttggctaccaaggtcgttcgtccttg
ccatccgaatttgattgtaagttggcctattcctacggtcatgcagcttccatagtgatt
gaaagtggcctcacagggtacatcgtctcgataagggggctctgtggaaatattaaagac
tggaaattgttcgccatcccatttatatcattgatgaagattttgccccgcggacagggc
agcaaatatttgaagagcgcctccaagggggacctccccgtcatccctagtgcgccggtt
gacctgaacggcaaggcgtatagaagcttaaaaattgctttgcaaaagtggcagatggag
gataggttttgcaacccgggtcccatccagtttgagggaaatgcttccatctattacaac
cgcattttgttcgaagagcagtccgagtatttcgagatgcttcgctacgtggagtgctac
gcgaacattttgaaggacacctgccgcttcggggtctcagcggattacctgaagaacgtg
ttcgtgcagctgtgcggcatgcttgtgctcgcctacaagccgaacgacattctctccaac
atgccctacatcggcagcatcgaggattactacgactgggagaaccagcgcaagcggatg
gactga

DBGET integrated database retrieval system