KEGG   Plasmodium vivax: PVX_099200Help
Entry
PVX_099200        CDS       T01073                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pvx  Plasmodium vivax
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:pvx01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pvx01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pvx00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pvx00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pvx00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pvx00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1421 aa AA seqDB search
MHNLNDNAGEGKKPSPDSLVKTMSVLLRDNECAFNMEEHEEQRSTDQGPSDKKDSEMIDC
LMQKLTSKKFLVEKETKNSFYLVDNENMKIKKLKEHGHSASLNDDLSPLQYERIKYQPTL
PKALASEYQLLEENHGDDFINKKDYEEIKQYLKNLHDMPILNVKETTNHESFKGGNVLKI
GIILSGGPAPGGHNVISGIYDYAKRYNEQSQVIGFLGGIDGLYSKNYVTVTDSLMNRFRN
LGGFNMLWSGRGKVRNKDDLIAIENIVAKLKLNGLVIIGGDGSNSNAALISEYFAERNIP
ISIIGIPKTIDGDLKSEAIEISFGFDTATKTYSEVIGNLCTDVKTGHNVYHVVRVMGRSA
SHVVLECALQTRPNIVLIGEEVEKEKLSLKDIVSNIVNTILKRRSLNKNYGVILIPEGLI
EFVPEIKVLIGELNVILKEGPFDADKLKHSREVWDFLPSIIRDQLLMDRESTGYIQVGKI
ATERLIIVLVESELAKLNDNSLNIQFMAHYLGYEGRCAIPSNFDCNYCYALGYNAALLID
HKKTGYMSIIQNLEDSYANWIPAAIPFLRIMHVNRDNTGKEFPAVKRYLVDLNSPLFNVL
KEVRSLWSLYDLYRAPGPIQFNGHLSNSRCYTVKIPTKDVLLCQNSDDLQLIISLANKTN
HLGSSNITGGAEDGGASQMDLSGKDADLQSKGGELGAVGATSTGAHEKSLSSYSPDAGQH
HSGTVAGKMITPPDMASEASINVDQVRNDFYEQHCSSYKSLGCMSELQTSRLYNKLELPE
LCSDLKAKVRAGKQYISNDPYTQKQILSNYPHMSYENKFQIQEIFHDKYATPISFEIKIG
IVFLSRQAPGAMNVLCGLYHRLKLLKGVCIAFYGLYGLLNNKYIIIDDDNIAKHLNQGGL
ELTGNSPEHSLFDKENRNKVCETVTNLQLNGLVMPGSNVTITEAALLAEYFLEKKIPTSV
VGIPLTGSNNLIHELIETCVGFDSSTKVYASLIGNVLTDAVSMPKYWHFIRLMGRSPSHE
VLECALQTHPNMVIISEEYGAADKTLWRVVQDIADVVCARAELGKNYGTVLIPDALLMHL
PHMKILLTEISDILNDANEKGQLVEARNDLVNLSTTQGAAAGTAGTAGTVAGAEQPLSAS
PWVLKLTPWSLALLKTFPQFIIKELLHVDLRSMRFEKLETEQLLLQMVKEELHQRKQKGK
YSGSFMGLTHFFGYQGRSSLPSEFDCKLAYSYGHAASIVIESGLTGYIVSIRGLCGNIKD
WKLFAIPFISLMKILPRGQGSKYLKSASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQME
DRFCNPGPIQFEGNASIYYNRILFEEQSEYFEMLRYVECYANILKDTCRFGVSADYLKNV
FVQLCGMLVLAYKPNDILSNMPYIGSIEDYYDWENQRKRMD
NT seq 4266 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacttgaacgacaacgccggagagggtaagaagccatccccggactccctcgtc
aaaacgatgtccgtgctgctaagggacaacgaatgcgctttcaatatggaagagcacgaa
gagcaacgaagcacagatcaaggaccgtcggacaaaaaagacagtgagatgattgactgt
ttgatgcaaaagctgacgtcgaaaaagttcctagtggaaaaggaaacgaagaactccttc
taccttgtagataacgaaaatatgaagataaaaaagttaaaggaacatggccattcggca
tcgctaaatgatgatttgagtcctctgcagtatgagaggataaagtaccaacccacatta
cccaaggcgttggcaagcgagtaccagctattggaagagaaccacggggatgattttatt
aacaaaaaggattatgaggagatcaaacagtatttgaagaacctgcacgatatgcccatt
ttgaacgtgaaggaaacgactaaccatgaatcttttaagggaggaaatgtgttaaaaatt
gggatcatcctctcaggtggtcccgccccaggtggccacaacgtcatatctggtatatat
gactatgctaagaggtacaacgagcagtcgcaggttattggctttttaggaggcatcgat
ggcttgtatagcaaaaactacgtcaccgttacggactcgttgatgaatcgatttaggaac
ttgggtgggttcaacatgctgtggtcaggccgagggaaggtgagaaataaagacgacttg
attgccatcgaaaatattgttgccaagttgaagctgaacgggttggtaataatcggaggg
gatggatccaacagtaacgcagcattgatttctgagtacttcgcggagaggaacattccc
atttctattattggcatcccgaagaccatcgatggggatttaaaaagtgaagcaattgaa
attagctttggattcgacaccgccacgaagacgtattcagaagtgataggcaatctgtgt
actgatgtgaagaccgggcataatgtataccacgtggtgagggtgatggggaggtccgcc
tcccatgtggtgttggagtgcgctctgcagacgaggccgaacatagtcctcataggggag
gaagtggagaaggagaagctatccctaaaggatatcgtaagcaacattgtgaataccatt
ttgaagagaaggtcgcttaacaaaaactacggagttattttaattcccgaggggttgatc
gaatttgtgcccgaaattaaggttttgattggcgagctgaacgtcattttgaaggaaggc
ccttttgatgcggataaattgaagcactccagagaggtgtgggatttcctgcccagtatc
attcgggaccagcttctaatggatagggaatccaccgggtatattcaagtgggcaaaatc
gcaacggagaggttaatcattgttctggtcgaatcggagctagccaaattgaatgacaac
agtttgaacattcagtttatggctcactatttagggtacgaggggaggtgtgccatcccg
tccaacttcgattgcaactattgctatgcgttggggtataatgccgctctgctaattgat
cataagaagacggggtacatgtctatcatacagaatttggaagattcgtatgcgaattgg
atccccgccgccattccgtttttgcgcatcatgcatgtgaatagggacaacacagggaag
gagttccccgctgtgaagaggtacctcgtcgatttgaacagcccccttttcaacgtgttg
aaagaagtccgtagtttgtggtccctctacgatttgtacagagcccctgggccgattcag
ttcaatgggcacttgagcaactccaggtgctacacggtgaagatacccacgaaggatgtg
ctgttgtgtcagaactcggacgacttgcagttgattatcagtttggcgaataagaccaac
catttaggaagcagcaacatcaccggaggtgcagaagatgggggggccagccagatggac
ttaagcggaaaagatgccgatttgcagagtaaggggggcgaacttggtgcggttggcgcc
acatcgacgggggcgcacgaaaagagcttatcctcttacagccccgatgcgggacaacac
cactctggaaccgtcgcagggaagatgattacccccccggacatggcgagcgaggcgagt
atcaacgtggatcaagtgagaaacgacttctacgaacagcactgctccagttacaagtcc
ctagggtgcatgtccgagttgcagacctccaggctgtataacaaattggagctgcctgaa
ctgtgctccgatttgaaggccaaagtgagggcaggaaaacagtacatatcgaatgacccc
tacacacagaagcagatcttgtccaattacccccacatgtcatatgaaaataaatttcaa
attcaggagattttccacgataagtatgccacgccgatctcgtttgaaataaaaatagga
attgtctttctgtctagacaggctcccggggcgatgaacgttctgtgtggtctgtaccac
cgactgaagcttctgaaaggggtgtgcattgccttttacgggttatatggcctcttaaat
aataagtacatcattatagacgacgacaatatagcgaagcatttgaaccagggaggattg
gagttgactggaaattccccggagcattccctatttgataaggagaaccgaaataaggtg
tgcgaaacggtcaccaatttgcagctcaacgggttggtgatgcctgggtccaatgtcacc
atcacggaagcggccctccttgcggagtacttcctggaaaagaagatccccacctccgtt
gtgggaattcctctaacgggttcgaataatttgattcacgagttgatagaaacgtgcgta
gggtttgacagcagcacgaaagtgtatgcctctctcattggaaatgtccttacagatgcg
gtgagcatgccgaagtattggcatttcattcgtctaatgggaagatctccttcgcatgaa
gtcctcgagtgcgccctgcagactcacccgaatatggtcatcatctcggaggagtatggg
gcggcggataagacgctctggagagtcgtccaagacattgcggacgtcgtctgtgcgagg
gccgagttgggaaagaactacgggacggtgttaatccccgatgcgctcctcatgcatctg
ccccatatgaagattctgctgaccgaaattagcgacatactgaacgacgccaatgagaag
gggcagctggtcgaggcgaggaacgacttggtgaatctctccaccacgcagggtgcggcg
gcgggtacggcgggtacagcgggtacagtggcgggagcggagcagcccctgtccgcttct
ccttgggtgctaaaactaaccccgtggagtttggccctgctgaagaccttcccccagttc
atcatcaaggagctcctgcacgtggatttgaggtccatgcggtttgaaaagctagagaca
gagcagctgctcctgcaaatggtgaaggaggaactgcatcagagaaagcaaaagggaaag
tactctggaagtttcatgggattgacccacttctttggctaccaaggtcgttcgtccttg
ccatccgaatttgattgtaagttggcctattcctacggtcatgcagcttccatagtgatt
gaaagtggcctcacagggtacatcgtctcgataagggggctctgtggaaatattaaagac
tggaaattgttcgccatcccatttatatcattgatgaagattttgccccgcggacagggc
agcaaatatttgaagagcgcctccaagggggacctccccgtcatccctagtgcgccggtt
gacctgaacggcaaggcgtatagaagcttaaaaattgctttgcaaaagtggcagatggag
gataggttttgcaacccgggtcccatccagtttgagggaaatgcttccatctattacaac
cgcattttgttcgaagagcagtccgagtatttcgagatgcttcgctacgtggagtgctac
gcgaacattttgaaggacacctgccgcttcggggtctcagcggattacctgaagaacgtg
ttcgtgcagctgtgcggcatgcttgtgctcgcctacaagccgaacgacattctctccaac
atgccctacatcggcagcatcgaggattactacgactgggagaaccagcgcaagcggatg
gactga

DBGET integrated database retrieval system