KEGG   Plasmodium vivax: PVX_099200Help
Entry
PVX_099200        CDS       T01073                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pvx  Plasmodium vivax
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:pvx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PVX_099200
   01230 Biosynthesis of amino acids
    PVX_099200
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PVX_099200
   00030 Pentose phosphate pathway
    PVX_099200
   00051 Fructose and mannose metabolism
    PVX_099200
   00052 Galactose metabolism
    PVX_099200
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PVX_099200
Enzymes [BR:pvx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PVX_099200
Protein phosphatases and associated proteins [BR:pvx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PVX_099200
Messenger RNA biogenesis [BR:pvx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PVX_099200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1421 aa AA seqDB search
MHNLNDNAGEGKKPSPDSLVKTMSVLLRDNECAFNMEEHEEQRSTDQGPSDKKDSEMIDC
LMQKLTSKKFLVEKETKNSFYLVDNENMKIKKLKEHGHSASLNDDLSPLQYERIKYQPTL
PKALASEYQLLEENHGDDFINKKDYEEIKQYLKNLHDMPILNVKETTNHESFKGGNVLKI
GIILSGGPAPGGHNVISGIYDYAKRYNEQSQVIGFLGGIDGLYSKNYVTVTDSLMNRFRN
LGGFNMLWSGRGKVRNKDDLIAIENIVAKLKLNGLVIIGGDGSNSNAALISEYFAERNIP
ISIIGIPKTIDGDLKSEAIEISFGFDTATKTYSEVIGNLCTDVKTGHNVYHVVRVMGRSA
SHVVLECALQTRPNIVLIGEEVEKEKLSLKDIVSNIVNTILKRRSLNKNYGVILIPEGLI
EFVPEIKVLIGELNVILKEGPFDADKLKHSREVWDFLPSIIRDQLLMDRESTGYIQVGKI
ATERLIIVLVESELAKLNDNSLNIQFMAHYLGYEGRCAIPSNFDCNYCYALGYNAALLID
HKKTGYMSIIQNLEDSYANWIPAAIPFLRIMHVNRDNTGKEFPAVKRYLVDLNSPLFNVL
KEVRSLWSLYDLYRAPGPIQFNGHLSNSRCYTVKIPTKDVLLCQNSDDLQLIISLANKTN
HLGSSNITGGAEDGGASQMDLSGKDADLQSKGGELGAVGATSTGAHEKSLSSYSPDAGQH
HSGTVAGKMITPPDMASEASINVDQVRNDFYEQHCSSYKSLGCMSELQTSRLYNKLELPE
LCSDLKAKVRAGKQYISNDPYTQKQILSNYPHMSYENKFQIQEIFHDKYATPISFEIKIG
IVFLSRQAPGAMNVLCGLYHRLKLLKGVCIAFYGLYGLLNNKYIIIDDDNIAKHLNQGGL
ELTGNSPEHSLFDKENRNKVCETVTNLQLNGLVMPGSNVTITEAALLAEYFLEKKIPTSV
VGIPLTGSNNLIHELIETCVGFDSSTKVYASLIGNVLTDAVSMPKYWHFIRLMGRSPSHE
VLECALQTHPNMVIISEEYGAADKTLWRVVQDIADVVCARAELGKNYGTVLIPDALLMHL
PHMKILLTEISDILNDANEKGQLVEARNDLVNLSTTQGAAAGTAGTAGTVAGAEQPLSAS
PWVLKLTPWSLALLKTFPQFIIKELLHVDLRSMRFEKLETEQLLLQMVKEELHQRKQKGK
YSGSFMGLTHFFGYQGRSSLPSEFDCKLAYSYGHAASIVIESGLTGYIVSIRGLCGNIKD
WKLFAIPFISLMKILPRGQGSKYLKSASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQME
DRFCNPGPIQFEGNASIYYNRILFEEQSEYFEMLRYVECYANILKDTCRFGVSADYLKNV
FVQLCGMLVLAYKPNDILSNMPYIGSIEDYYDWENQRKRMD
NT seq 4266 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacttgaacgacaacgccggagagggtaagaagccatccccggactccctcgtc
aaaacgatgtccgtgctgctaagggacaacgaatgcgctttcaatatggaagagcacgaa
gagcaacgaagcacagatcaaggaccgtcggacaaaaaagacagtgagatgattgactgt
ttgatgcaaaagctgacgtcgaaaaagttcctagtggaaaaggaaacgaagaactccttc
taccttgtagataacgaaaatatgaagataaaaaagttaaaggaacatggccattcggca
tcgctaaatgatgatttgagtcctctgcagtatgagaggataaagtaccaacccacatta
cccaaggcgttggcaagcgagtaccagctattggaagagaaccacggggatgattttatt
aacaaaaaggattatgaggagatcaaacagtatttgaagaacctgcacgatatgcccatt
ttgaacgtgaaggaaacgactaaccatgaatcttttaagggaggaaatgtgttaaaaatt
gggatcatcctctcaggtggtcccgccccaggtggccacaacgtcatatctggtatatat
gactatgctaagaggtacaacgagcagtcgcaggttattggctttttaggaggcatcgat
ggcttgtatagcaaaaactacgtcaccgttacggactcgttgatgaatcgatttaggaac
ttgggtgggttcaacatgctgtggtcaggccgagggaaggtgagaaataaagacgacttg
attgccatcgaaaatattgttgccaagttgaagctgaacgggttggtaataatcggaggg
gatggatccaacagtaacgcagcattgatttctgagtacttcgcggagaggaacattccc
atttctattattggcatcccgaagaccatcgatggggatttaaaaagtgaagcaattgaa
attagctttggattcgacaccgccacgaagacgtattcagaagtgataggcaatctgtgt
actgatgtgaagaccgggcataatgtataccacgtggtgagggtgatggggaggtccgcc
tcccatgtggtgttggagtgcgctctgcagacgaggccgaacatagtcctcataggggag
gaagtggagaaggagaagctatccctaaaggatatcgtaagcaacattgtgaataccatt
ttgaagagaaggtcgcttaacaaaaactacggagttattttaattcccgaggggttgatc
gaatttgtgcccgaaattaaggttttgattggcgagctgaacgtcattttgaaggaaggc
ccttttgatgcggataaattgaagcactccagagaggtgtgggatttcctgcccagtatc
attcgggaccagcttctaatggatagggaatccaccgggtatattcaagtgggcaaaatc
gcaacggagaggttaatcattgttctggtcgaatcggagctagccaaattgaatgacaac
agtttgaacattcagtttatggctcactatttagggtacgaggggaggtgtgccatcccg
tccaacttcgattgcaactattgctatgcgttggggtataatgccgctctgctaattgat
cataagaagacggggtacatgtctatcatacagaatttggaagattcgtatgcgaattgg
atccccgccgccattccgtttttgcgcatcatgcatgtgaatagggacaacacagggaag
gagttccccgctgtgaagaggtacctcgtcgatttgaacagcccccttttcaacgtgttg
aaagaagtccgtagtttgtggtccctctacgatttgtacagagcccctgggccgattcag
ttcaatgggcacttgagcaactccaggtgctacacggtgaagatacccacgaaggatgtg
ctgttgtgtcagaactcggacgacttgcagttgattatcagtttggcgaataagaccaac
catttaggaagcagcaacatcaccggaggtgcagaagatgggggggccagccagatggac
ttaagcggaaaagatgccgatttgcagagtaaggggggcgaacttggtgcggttggcgcc
acatcgacgggggcgcacgaaaagagcttatcctcttacagccccgatgcgggacaacac
cactctggaaccgtcgcagggaagatgattacccccccggacatggcgagcgaggcgagt
atcaacgtggatcaagtgagaaacgacttctacgaacagcactgctccagttacaagtcc
ctagggtgcatgtccgagttgcagacctccaggctgtataacaaattggagctgcctgaa
ctgtgctccgatttgaaggccaaagtgagggcaggaaaacagtacatatcgaatgacccc
tacacacagaagcagatcttgtccaattacccccacatgtcatatgaaaataaatttcaa
attcaggagattttccacgataagtatgccacgccgatctcgtttgaaataaaaatagga
attgtctttctgtctagacaggctcccggggcgatgaacgttctgtgtggtctgtaccac
cgactgaagcttctgaaaggggtgtgcattgccttttacgggttatatggcctcttaaat
aataagtacatcattatagacgacgacaatatagcgaagcatttgaaccagggaggattg
gagttgactggaaattccccggagcattccctatttgataaggagaaccgaaataaggtg
tgcgaaacggtcaccaatttgcagctcaacgggttggtgatgcctgggtccaatgtcacc
atcacggaagcggccctccttgcggagtacttcctggaaaagaagatccccacctccgtt
gtgggaattcctctaacgggttcgaataatttgattcacgagttgatagaaacgtgcgta
gggtttgacagcagcacgaaagtgtatgcctctctcattggaaatgtccttacagatgcg
gtgagcatgccgaagtattggcatttcattcgtctaatgggaagatctccttcgcatgaa
gtcctcgagtgcgccctgcagactcacccgaatatggtcatcatctcggaggagtatggg
gcggcggataagacgctctggagagtcgtccaagacattgcggacgtcgtctgtgcgagg
gccgagttgggaaagaactacgggacggtgttaatccccgatgcgctcctcatgcatctg
ccccatatgaagattctgctgaccgaaattagcgacatactgaacgacgccaatgagaag
gggcagctggtcgaggcgaggaacgacttggtgaatctctccaccacgcagggtgcggcg
gcgggtacggcgggtacagcgggtacagtggcgggagcggagcagcccctgtccgcttct
ccttgggtgctaaaactaaccccgtggagtttggccctgctgaagaccttcccccagttc
atcatcaaggagctcctgcacgtggatttgaggtccatgcggtttgaaaagctagagaca
gagcagctgctcctgcaaatggtgaaggaggaactgcatcagagaaagcaaaagggaaag
tactctggaagtttcatgggattgacccacttctttggctaccaaggtcgttcgtccttg
ccatccgaatttgattgtaagttggcctattcctacggtcatgcagcttccatagtgatt
gaaagtggcctcacagggtacatcgtctcgataagggggctctgtggaaatattaaagac
tggaaattgttcgccatcccatttatatcattgatgaagattttgccccgcggacagggc
agcaaatatttgaagagcgcctccaagggggacctccccgtcatccctagtgcgccggtt
gacctgaacggcaaggcgtatagaagcttaaaaattgctttgcaaaagtggcagatggag
gataggttttgcaacccgggtcccatccagtttgagggaaatgcttccatctattacaac
cgcattttgttcgaagagcagtccgagtatttcgagatgcttcgctacgtggagtgctac
gcgaacattttgaaggacacctgccgcttcggggtctcagcggattacctgaagaacgtg
ttcgtgcagctgtgcggcatgcttgtgctcgcctacaagccgaacgacattctctccaac
atgccctacatcggcagcatcgaggattactacgactgggagaaccagcgcaagcggatg
gactga

DBGET integrated database retrieval system